BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001459-TA|BGIBMGA001459-PA|undefined (51 letters) Database: fruitfly 52,641 sequences; 24,830,863 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X14037-1|CAA32198.1| 1053|Drosophila melanogaster polyprotein pr... 42 1e-04 >X14037-1|CAA32198.1| 1053|Drosophila melanogaster polyprotein protein. Length = 1053 Score = 41.5 bits (93), Expect = 1e-04 Identities = 20/40 (50%), Positives = 26/40 (65%) Query: 7 EEIVTSYVLAHVAQFDCRLHHMAFTNGNTTRNKLLQEIKA 46 EEI + VLAH+A D RL + FT+ TR+KL E+KA Sbjct: 144 EEIAVTTVLAHMANIDSRLQRVLFTSNVRTRSKLQAELKA 183 Database: fruitfly Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 24,830,863 Number of sequences in database: 52,641 Lambda K H 0.319 0.128 0.361 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,457,063 Number of Sequences: 52641 Number of extensions: 63962 Number of successful extensions: 99 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 98 Number of HSP's gapped (non-prelim): 1 length of query: 51 length of database: 24,830,863 effective HSP length: 32 effective length of query: 19 effective length of database: 23,146,351 effective search space: 439780669 effective search space used: 439780669 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -