SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001459-TA|BGIBMGA001459-PA|undefined
         (51 letters)

Database: fruitfly 
           52,641 sequences; 24,830,863 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X14037-1|CAA32198.1| 1053|Drosophila melanogaster polyprotein pr...    42   1e-04

>X14037-1|CAA32198.1| 1053|Drosophila melanogaster polyprotein
           protein.
          Length = 1053

 Score = 41.5 bits (93), Expect = 1e-04
 Identities = 20/40 (50%), Positives = 26/40 (65%)

Query: 7   EEIVTSYVLAHVAQFDCRLHHMAFTNGNTTRNKLLQEIKA 46
           EEI  + VLAH+A  D RL  + FT+   TR+KL  E+KA
Sbjct: 144 EEIAVTTVLAHMANIDSRLQRVLFTSNVRTRSKLQAELKA 183


  Database: fruitfly
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 24,830,863
  Number of sequences in database:  52,641
  
Lambda     K      H
   0.319    0.128    0.361 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,457,063
Number of Sequences: 52641
Number of extensions: 63962
Number of successful extensions: 99
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 98
Number of HSP's gapped (non-prelim): 1
length of query: 51
length of database: 24,830,863
effective HSP length: 32
effective length of query: 19
effective length of database: 23,146,351
effective search space: 439780669
effective search space used: 439780669
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 53 (25.4 bits)

- SilkBase 1999-2023 -