GeneModel BLAST Result against spombe

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001455-TA|BGIBMGA001455-PA|undefined
         (152 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC947.11c |elg1||DNA replication factor C complex subunit Elg1...    24   8.7  

>SPBC947.11c |elg1||DNA replication factor C complex subunit
           Elg1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 920

 Score = 24.2 bits (50), Expect = 8.7
 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 8/67 (11%)

Query: 11  YHNPRILANKTSLTVVPQQASTAASTGPSQPTHRASWSYGTQFHCFITPLQFIAAHDRII 70
           Y   R+ + K  L+   + AS  +  G +     A ++YG         LQ++   DRI+
Sbjct: 860 YDRIRLNSYKLLLSSKGRSASHISRRGAASILRSAGYNYGR--------LQYLEGSDRIL 911

Query: 71  NAWGHTS 77
           + W  T+
Sbjct: 912 STWFSTT 918


  Database: spombe
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.322    0.128    0.425 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 572,004
Number of Sequences: 5004
Number of extensions: 18725
Number of successful extensions: 28
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 28
Number of HSP's gapped (non-prelim): 1
length of query: 152
length of database: 2,362,478
effective HSP length: 67
effective length of query: 85
effective length of database: 2,027,210
effective search space: 172312850
effective search space used: 172312850
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 50 (24.2 bits)