BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001455-TA|BGIBMGA001455-PA|undefined (152 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC947.11c |elg1||DNA replication factor C complex subunit Elg1... 24 8.7 >SPBC947.11c |elg1||DNA replication factor C complex subunit Elg1|Schizosaccharomyces pombe|chr 2|||Manual Length = 920 Score = 24.2 bits (50), Expect = 8.7 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 8/67 (11%) Query: 11 YHNPRILANKTSLTVVPQQASTAASTGPSQPTHRASWSYGTQFHCFITPLQFIAAHDRII 70 Y R+ + K L+ + AS + G + A ++YG LQ++ DRI+ Sbjct: 860 YDRIRLNSYKLLLSSKGRSASHISRRGAASILRSAGYNYGR--------LQYLEGSDRIL 911 Query: 71 NAWGHTS 77 + W T+ Sbjct: 912 STWFSTT 918 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.322 0.128 0.425 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 572,004 Number of Sequences: 5004 Number of extensions: 18725 Number of successful extensions: 28 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 28 Number of HSP's gapped (non-prelim): 1 length of query: 152 length of database: 2,362,478 effective HSP length: 67 effective length of query: 85 effective length of database: 2,027,210 effective search space: 172312850 effective search space used: 172312850 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -