BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001451-TA|BGIBMGA001451-PA|undefined (84 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_03_0052 - 14456925-14457176,14457277-14457437,14457843-144579... 25 5.7 04_04_0273 - 24076664-24077701 25 7.6 >02_03_0052 - 14456925-14457176,14457277-14457437,14457843-14457914, 14458105-14458221,14458310-14458322,14458917-14458946, 14459837-14460010,14460276-14460417,14460731-14460792, 14461047-14461643 Length = 539 Score = 25.4 bits (53), Expect = 5.7 Identities = 9/23 (39%), Positives = 15/23 (65%) Query: 2 QMLASLILACAFCGVRSVIRTPL 24 Q L ++L FC ++SV++ PL Sbjct: 320 QSLIGMVLVTTFCYLKSVVQVPL 342 >04_04_0273 - 24076664-24077701 Length = 345 Score = 25.0 bits (52), Expect = 7.6 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Query: 7 LILACAFCGVRSVIRTPLEA--FRPSAEIHIR 36 L+LACA VR+V+ LE RP H+R Sbjct: 160 LVLACAAAAVRAVMGMDLEPQFDRPYLSAHLR 191 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.323 0.134 0.376 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,687,013 Number of Sequences: 37544 Number of extensions: 39201 Number of successful extensions: 66 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 65 Number of HSP's gapped (non-prelim): 2 length of query: 84 length of database: 14,793,348 effective HSP length: 63 effective length of query: 21 effective length of database: 12,428,076 effective search space: 260989596 effective search space used: 260989596 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -