BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001450-TA|BGIBMGA001450-PA|IPR004182|GRAM (374 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 26 0.60 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 26 0.60 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 25.8 bits (54), Expect = 0.60 Identities = 11/53 (20%), Positives = 26/53 (49%) Query: 54 RQKKFQRHFPQVGPEEKVLNYYSCALVGDLLLQGHLYITKNYFAFYSNVFGYV 106 R+++ + Q PE+ LNYY+ ++ D+ ++ + + F + Y+ Sbjct: 176 REERQAYYLHQFAPEQPDLNYYNPVVLDDMQNVLRFWLRRGFDGFRVDALPYI 228 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 25.8 bits (54), Expect = 0.60 Identities = 11/53 (20%), Positives = 26/53 (49%) Query: 54 RQKKFQRHFPQVGPEEKVLNYYSCALVGDLLLQGHLYITKNYFAFYSNVFGYV 106 R+++ + Q PE+ LNYY+ ++ D+ ++ + + F + Y+ Sbjct: 176 REERQAYYLHQFAPEQPDLNYYNPVVLDDMQNVLRFWLRRGFDGFRVDALPYI 228 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.317 0.132 0.389 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,300 Number of Sequences: 429 Number of extensions: 3968 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 2 length of query: 374 length of database: 140,377 effective HSP length: 59 effective length of query: 315 effective length of database: 115,066 effective search space: 36245790 effective search space used: 36245790 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -