BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001449-TA|BGIBMGA001449-PA|undefined (117 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 23 2.8 DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. 22 6.6 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 24 YSKSRECPDQNKPRTDLHSKKSAKRVSLHLEEA 56 Y + RE P+ K LH + +++L ++ A Sbjct: 261 YKQIREAPEMEKMNEKLHIGRRTAKLNLRMKVA 293 >DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. Length = 383 Score = 21.8 bits (44), Expect = 6.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Query: 2 KETYPDEIMLCFVQGFGDSER 22 K T ++ + V GF DSER Sbjct: 57 KSTIVKQMRILHVNGFSDSER 77 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.312 0.129 0.366 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,122 Number of Sequences: 2123 Number of extensions: 3856 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 117 length of database: 516,269 effective HSP length: 56 effective length of query: 61 effective length of database: 397,381 effective search space: 24240241 effective search space used: 24240241 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -