BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001446-TA|BGIBMGA001446-PA|undefined (88 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 21 2.6 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 20 3.4 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 20.6 bits (41), Expect = 2.6 Identities = 9/25 (36%), Positives = 14/25 (56%) Query: 19 ELGNLLEEFSTLALSSEQPEKTTNN 43 E+G + E + LS +PEK T + Sbjct: 161 EVGGVEEAKGPVDLSKSEPEKKTES 185 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 20.2 bits (40), Expect = 3.4 Identities = 10/30 (33%), Positives = 15/30 (50%) Query: 26 EFSTLALSSEQPEKTTNNFEKPGILDFLRS 55 E L ++++ EK+ NF G D RS Sbjct: 322 EQQELYMAAQVIEKSVANFTAAGFFDVKRS 351 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.313 0.127 0.340 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,210 Number of Sequences: 317 Number of extensions: 553 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 88 length of database: 114,650 effective HSP length: 47 effective length of query: 41 effective length of database: 99,751 effective search space: 4089791 effective search space used: 4089791 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 37 (19.7 bits) S2: 37 (19.0 bits)
- SilkBase 1999-2023 -