BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001446-TA|BGIBMGA001446-PA|undefined (88 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 22 2.8 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 21 4.9 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 22.2 bits (45), Expect = 2.8 Identities = 8/24 (33%), Positives = 17/24 (70%) Query: 45 EKPGILDFLRSQKRDIPNATAAAV 68 E P +L ++++Q RD+ +A A++ Sbjct: 1632 EDPPVLKYIKNQVRDVFHAPIASL 1655 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 21.4 bits (43), Expect = 4.9 Identities = 14/57 (24%), Positives = 25/57 (43%) Query: 15 MVRRELGNLLEEFSTLALSSEQPEKTTNNFEKPGILDFLRSQKRDIPNATAAAVNIV 71 +V ++ ++LE L L EK F++ +LD S+ +VNI+ Sbjct: 1676 LVDQKNNSVLEVHQVLQLLDTHVEKLDRLFKEFNVLDTQASELVQTAEMDELSVNII 1732 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.313 0.127 0.340 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 75,825 Number of Sequences: 2123 Number of extensions: 2292 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 88 length of database: 516,269 effective HSP length: 54 effective length of query: 34 effective length of database: 401,627 effective search space: 13655318 effective search space used: 13655318 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.5 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -