GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001444-TA|BGIBMGA001444-PA|IPR000618|Insect cuticle
protein, IPR011047|Quinonprotein alcohol dehydrogenase-like,
IPR006970|PT repeat
         (320 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U09586-2|AAC47271.1|  712|Tribolium castaneum protease, reverse ...    21   9.1  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    21   9.1  
AY584475-1|AAS93634.1|  209|Tribolium castaneum homothorax protein.    21   9.1  
AJ518941-1|CAD57735.1|  456|Tribolium castaneum homothorax protein.    21   9.1  

>U09586-2|AAC47271.1|  712|Tribolium castaneum protease, reverse
           transcriptase andRNase H protein.
          Length = 712

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 10/31 (32%), Positives = 15/31 (48%)

Query: 195 HYWADKTGYHAYGDHLPTPPPVPAAIQAALD 225
           H +  +   H     L  P PVP A++ A+D
Sbjct: 292 HKYTHEIKLHDKTPFLKRPYPVPFALRPAVD 322


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 5/9 (55%), Positives = 8/9 (88%)

Query: 192  YTVHYWADK 200
            +T+HYW +K
Sbjct: 2046 FTIHYWIEK 2054


>AY584475-1|AAS93634.1|  209|Tribolium castaneum homothorax protein.
          Length = 209

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 5/12 (41%), Positives = 9/12 (75%)

Query: 63  QWKPQNTWNAPP 74
           +W P+  W++PP
Sbjct: 118 KWCPRREWSSPP 129


>AJ518941-1|CAD57735.1|  456|Tribolium castaneum homothorax protein.
          Length = 456

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 5/12 (41%), Positives = 9/12 (75%)

Query: 63  QWKPQNTWNAPP 74
           +W P+  W++PP
Sbjct: 274 KWCPRREWSSPP 285


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.311    0.131    0.407 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 58,297
Number of Sequences: 317
Number of extensions: 2081
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of query: 320
length of database: 114,650
effective HSP length: 57
effective length of query: 263
effective length of database: 96,581
effective search space: 25400803
effective search space used: 25400803
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.8 bits)
S2: 43 (21.4 bits)