GeneModel BLAST Result against spombe

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001444-TA|BGIBMGA001444-PA|IPR000618|Insect cuticle
protein, IPR011047|Quinonprotein alcohol dehydrogenase-like,
IPR006970|PT repeat
         (320 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC31A2.11c |cuf1||Cu metalloregulatory transcription factor Cu...    27   2.7  

>SPAC31A2.11c |cuf1||Cu metalloregulatory transcription factor Cuf1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 411

 Score = 27.5 bits (58), Expect = 2.7
 Identities = 12/37 (32%), Positives = 19/37 (51%)

Query: 133 VPVIKNEMYYGDNGSYKYEYQIADGTHVGEEGYFTNP 169
           VP+  +   YG + SY YE  I + T+  +  Y  +P
Sbjct: 272 VPLPSSTNTYGPSNSYGYEININESTNHVDSSYLPHP 308


  Database: spombe
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.311    0.131    0.407 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,083,591
Number of Sequences: 5004
Number of extensions: 35188
Number of successful extensions: 65
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 64
Number of HSP's gapped (non-prelim): 1
length of query: 320
length of database: 2,362,478
effective HSP length: 73
effective length of query: 247
effective length of database: 1,997,186
effective search space: 493304942
effective search space used: 493304942
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.8 bits)
S2: 54 (25.8 bits)