BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001444-TA|BGIBMGA001444-PA|IPR000618|Insect cuticle protein, IPR011047|Quinonprotein alcohol dehydrogenase-like, IPR006970|PT repeat (320 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_53703| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 >SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1926 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/76 (27%), Positives = 32/76 (42%), Gaps = 2/76 (2%) Query: 134 PVIKNEMYYGDNGSYKYEYQIADGTHVGEEGYFTNPNTEEASLVKKGWYSYTGADGKVY- 192 P + E+YY D E A G G++G P E + +Y+Y GAD + Y Sbjct: 1078 PYQEGEVYYYDEQGNIVEGYDA-GQVYGQDGQLLAPAVEATEAYGEEYYTYEGADQQAYP 1136 Query: 193 TVHYWADKTGYHAYGD 208 + + + G Y D Sbjct: 1137 SEQVYVEGQGEAQYAD 1152 >SB_53703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 28.3 bits (60), Expect = 8.8 Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 147 SYKYEYQIADGTHVGEEGYFTNPNTE 172 S ++E +I DG G++G F + NTE Sbjct: 43 STQWEVKIQDGARTGQKGIFRDDNTE 68 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.311 0.131 0.407 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,033,508 Number of Sequences: 59808 Number of extensions: 268619 Number of successful extensions: 438 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 437 Number of HSP's gapped (non-prelim): 2 length of query: 320 length of database: 16,821,457 effective HSP length: 82 effective length of query: 238 effective length of database: 11,917,201 effective search space: 2836293838 effective search space used: 2836293838 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -