BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001443-TA|BGIBMGA001443-PA|undefined (56 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC11G7.02 |pub1||ubiquitin-protein ligase E3|Schizosaccharomyc... 24 2.8 SPCC1183.04c |pet127||mitochondrial membrane protein Pet127|Schi... 23 6.4 >SPAC11G7.02 |pub1||ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 1|||Manual Length = 767 Score = 23.8 bits (49), Expect = 2.8 Identities = 13/44 (29%), Positives = 18/44 (40%) Query: 1 MEPAASTKNMTHAALPRSEAFHLRLEVQARARNKRQRGTIGLPP 44 + +AS+ N+T P S R E N G+ LPP Sbjct: 249 LHSSASSANVTEGVQPSSSNAARRTEASVLTSNATTAGSGELPP 292 >SPCC1183.04c |pet127||mitochondrial membrane protein Pet127|Schizosaccharomyces pombe|chr 3|||Manual Length = 524 Score = 22.6 bits (46), Expect = 6.4 Identities = 13/39 (33%), Positives = 17/39 (43%) Query: 12 HAALPRSEAFHLRLEVQARARNKRQRGTIGLPPRSAAFD 50 H PR + LR ++ R KR+ I PP S D Sbjct: 474 HFRKPRDQDNLLRNYIRLRDDIKRRESKISNPPESLLHD 512 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.320 0.128 0.374 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 216,268 Number of Sequences: 5004 Number of extensions: 5022 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 2 length of query: 56 length of database: 2,362,478 effective HSP length: 37 effective length of query: 19 effective length of database: 2,177,330 effective search space: 41369270 effective search space used: 41369270 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -