GeneModel BLAST Result against nematostella

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001443-TA|BGIBMGA001443-PA|undefined
         (56 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_46970| Best HMM Match : zf-nanos (HMM E-Value=2.6e-35)              26   4.9  

>SB_46970| Best HMM Match : zf-nanos (HMM E-Value=2.6e-35)
          Length = 216

 Score = 25.8 bits (54), Expect = 4.9
 Identities = 11/37 (29%), Positives = 20/37 (54%)

Query: 1   MEPAASTKNMTHAALPRSEAFHLRLEVQARARNKRQR 37
           MEP   +K +  + LP + +   R ++   ARN++ R
Sbjct: 105 MEPHFGSKAVGSSLLPGTRSLTKRTDIDTAARNRKNR 141


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.320    0.128    0.374 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,732,877
Number of Sequences: 59808
Number of extensions: 43676
Number of successful extensions: 62
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 61
Number of HSP's gapped (non-prelim): 1
length of query: 56
length of database: 16,821,457
effective HSP length: 36
effective length of query: 20
effective length of database: 14,668,369
effective search space: 293367380
effective search space used: 293367380
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 52 (25.0 bits)