GeneModel BLAST Result against celegans

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001443-TA|BGIBMGA001443-PA|undefined
         (56 letters)

Database: celegans 
           27,539 sequences; 12,573,161 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF003151-19|AAK18922.1|  988|Caenorhabditis elegans Hypothetical...    25   4.8  

>AF003151-19|AAK18922.1|  988|Caenorhabditis elegans Hypothetical
           protein D1007.7 protein.
          Length = 988

 Score = 25.4 bits (53), Expect = 4.8
 Identities = 12/33 (36%), Positives = 17/33 (51%)

Query: 24  RLEVQARARNKRQRGTIGLPPRSAAFDICLSPT 56
           RL  + + R  ++R  +GLPP    F I  S T
Sbjct: 494 RLREKEKERESKERRRMGLPPVRIGFTIIASRT 526


  Database: celegans
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 12,573,161
  Number of sequences in database:  27,539
  
Lambda     K      H
   0.320    0.128    0.374 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,226,276
Number of Sequences: 27539
Number of extensions: 28702
Number of successful extensions: 49
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 48
Number of HSP's gapped (non-prelim): 1
length of query: 56
length of database: 12,573,161
effective HSP length: 37
effective length of query: 19
effective length of database: 11,554,218
effective search space: 219530142
effective search space used: 219530142
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 51 (24.6 bits)