SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001442-TA|BGIBMGA001442-PA|undefined
         (49 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q554S1 Cluster: Putative uncharacterized protein; n=2; ...    31   3.3  

>UniRef50_Q554S1 Cluster: Putative uncharacterized protein; n=2;
           Dictyostelium discoideum|Rep: Putative uncharacterized
           protein - Dictyostelium discoideum AX4
          Length = 1179

 Score = 31.5 bits (68), Expect = 3.3
 Identities = 13/32 (40%), Positives = 20/32 (62%)

Query: 14  TPNKKETMKTFKLHLKEKSALPYQRKVALQNM 45
           T N+KE ++  K++ K K  LP   KV++ NM
Sbjct: 410 TNNEKEVLEFLKIYFKSKHLLPELNKVSIDNM 441


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.317    0.126    0.357 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 46,784,669
Number of Sequences: 1657284
Number of extensions: 1043465
Number of successful extensions: 2919
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2918
Number of HSP's gapped (non-prelim): 1
length of query: 49
length of database: 575,637,011
effective HSP length: 30
effective length of query: 19
effective length of database: 525,918,491
effective search space: 9992451329
effective search space used: 9992451329
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 65 (30.3 bits)

- SilkBase 1999-2023 -