BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001442-TA|BGIBMGA001442-PA|undefined
(49 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_Q554S1 Cluster: Putative uncharacterized protein; n=2; ... 31 3.3
>UniRef50_Q554S1 Cluster: Putative uncharacterized protein; n=2;
Dictyostelium discoideum|Rep: Putative uncharacterized
protein - Dictyostelium discoideum AX4
Length = 1179
Score = 31.5 bits (68), Expect = 3.3
Identities = 13/32 (40%), Positives = 20/32 (62%)
Query: 14 TPNKKETMKTFKLHLKEKSALPYQRKVALQNM 45
T N+KE ++ K++ K K LP KV++ NM
Sbjct: 410 TNNEKEVLEFLKIYFKSKHLLPELNKVSIDNM 441
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.317 0.126 0.357
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 46,784,669
Number of Sequences: 1657284
Number of extensions: 1043465
Number of successful extensions: 2919
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2918
Number of HSP's gapped (non-prelim): 1
length of query: 49
length of database: 575,637,011
effective HSP length: 30
effective length of query: 19
effective length of database: 525,918,491
effective search space: 9992451329
effective search space used: 9992451329
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 65 (30.3 bits)
- SilkBase 1999-2023 -