BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001442-TA|BGIBMGA001442-PA|undefined (49 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 1.2 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 1.2 DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase rever... 19 3.8 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 19 3.8 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 19 3.8 DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory pro... 19 5.0 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 18 6.7 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 18 6.7 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 18 6.7 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 18 6.7 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 20.6 bits (41), Expect = 1.2 Identities = 8/21 (38%), Positives = 13/21 (61%) Query: 13 KTPNKKETMKTFKLHLKEKSA 33 K P+ K+ + F L++KE A Sbjct: 475 KKPHIKKPLNAFMLYMKEMRA 495 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 20.6 bits (41), Expect = 1.2 Identities = 8/21 (38%), Positives = 13/21 (61%) Query: 13 KTPNKKETMKTFKLHLKEKSA 33 K P+ K+ + F L++KE A Sbjct: 367 KKPHIKKPLNAFMLYMKEMRA 387 >DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase reverse transcriptase protein. Length = 73 Score = 19.0 bits (37), Expect = 3.8 Identities = 9/25 (36%), Positives = 13/25 (52%) Query: 21 MKTFKLHLKEKSALPYQRKVALQNM 45 +K F+L K K+ P Q LQ + Sbjct: 31 LKNFRLCKKHKTKKPVQILALLQEI 55 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 19.0 bits (37), Expect = 3.8 Identities = 9/25 (36%), Positives = 13/25 (52%) Query: 21 MKTFKLHLKEKSALPYQRKVALQNM 45 +K F+L K K+ P Q LQ + Sbjct: 31 LKNFRLCKKHKTKKPVQILALLQEI 55 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 19.0 bits (37), Expect = 3.8 Identities = 13/43 (30%), Positives = 25/43 (58%), Gaps = 3/43 (6%) Query: 6 WTLRLTGKTPNKKETMKTFKLHLK--EKSALPYQ-RKVALQNM 45 + +RL G + +KK+ +++ L +K KS +P + LQN+ Sbjct: 129 YDIRLWGVSFSKKQILRSDDLAVKTTSKSLVPTPVTHIFLQNL 171 >DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory protein 7 protein. Length = 127 Score = 18.6 bits (36), Expect = 5.0 Identities = 8/22 (36%), Positives = 13/22 (59%) Query: 17 KKETMKTFKLHLKEKSALPYQR 38 +KET + HL +K A ++R Sbjct: 81 QKETAEKVIRHLTQKRARDWER 102 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 18.2 bits (35), Expect = 6.7 Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 19 ETMKTFKLHLKEKSALPYQ 37 ET+K +KL+ EK Y+ Sbjct: 68 ETLKRYKLNDLEKRREVYE 86 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 18.2 bits (35), Expect = 6.7 Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 19 ETMKTFKLHLKEKSALPYQ 37 ET+K +KL+ EK Y+ Sbjct: 228 ETLKRYKLNDLEKRREVYE 246 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 18.2 bits (35), Expect = 6.7 Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 19 ETMKTFKLHLKEKSALPYQ 37 ET+K +KL+ EK Y+ Sbjct: 228 ETLKRYKLNDLEKRREVYE 246 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 18.2 bits (35), Expect = 6.7 Identities = 6/10 (60%), Positives = 7/10 (70%) Query: 11 TGKTPNKKET 20 +G TPNK T Sbjct: 61 SGNTPNKSST 70 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.126 0.357 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9888 Number of Sequences: 317 Number of extensions: 214 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of query: 49 length of database: 114,650 effective HSP length: 30 effective length of query: 19 effective length of database: 105,140 effective search space: 1997660 effective search space used: 1997660 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 34 (18.5 bits) S2: 34 (17.8 bits)
- SilkBase 1999-2023 -