BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001442-TA|BGIBMGA001442-PA|undefined (49 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0645 + 4820461-4820736,4821034-4821086,4821670-4821876,482... 26 4.3 09_02_0523 + 10196272-10196375,10196551-10197488,10200247-102008... 25 5.7 03_05_0807 + 27849637-27849823,27850002-27850294,27850736-278509... 25 7.5 >02_01_0645 + 4820461-4820736,4821034-4821086,4821670-4821876, 4821975-4822055,4822137-4822302 Length = 260 Score = 25.8 bits (54), Expect = 4.3 Identities = 10/28 (35%), Positives = 16/28 (57%) Query: 5 RWTLRLTGKTPNKKETMKTFKLHLKEKS 32 RW R T P+KKE ++ +K+K+ Sbjct: 121 RWAQRRTSSKPDKKEPLEVEDKDIKQKA 148 >09_02_0523 + 10196272-10196375,10196551-10197488,10200247-10200896, 10201003-10201746 Length = 811 Score = 25.4 bits (53), Expect = 5.7 Identities = 12/43 (27%), Positives = 19/43 (44%) Query: 6 WTLRLTGKTPNKKETMKTFKLHLKEKSALPYQRKVALQNMADI 48 W LTGK + T F + ++ + +PY K+ M I Sbjct: 356 WNRDLTGKGDSHGRTPLHFAVSIEPPTKIPYYHKILFSIMRHI 398 >03_05_0807 + 27849637-27849823,27850002-27850294,27850736-27850973, 27851075-27851410,27851496-27851581,27851678-27851785, 27851878-27852185,27852265-27852528,27852610-27853381 Length = 863 Score = 25.0 bits (52), Expect = 7.5 Identities = 12/37 (32%), Positives = 19/37 (51%) Query: 11 TGKTPNKKETMKTFKLHLKEKSALPYQRKVALQNMAD 47 TG+ P KK+ +L L E+ +P + A M+D Sbjct: 232 TGRIPTKKDPNSESRLSLLEQIYVPSDERFAHLKMSD 268 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.317 0.126 0.357 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,158,067 Number of Sequences: 37544 Number of extensions: 25214 Number of successful extensions: 65 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 62 Number of HSP's gapped (non-prelim): 3 length of query: 49 length of database: 14,793,348 effective HSP length: 30 effective length of query: 19 effective length of database: 13,667,028 effective search space: 259673532 effective search space used: 259673532 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -