BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001441-TA|BGIBMGA001441-PA|undefined (197 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146741-1|AAO12101.1| 131|Anopheles gambiae odorant-binding pr... 27 0.29 AY146728-1|AAO12088.1| 131|Anopheles gambiae odorant-binding pr... 24 3.5 >AY146741-1|AAO12101.1| 131|Anopheles gambiae odorant-binding protein AgamOBP10 protein. Length = 131 Score = 27.5 bits (58), Expect = 0.29 Identities = 11/31 (35%), Positives = 18/31 (58%) Query: 121 LDAMVARVHYEFADILGRYDCDQAYSVHSCY 151 +DA A+ + + D+ CD AY+V+ CY Sbjct: 93 MDADKAKDYVQQCDLRRTNPCDTAYAVYDCY 123 >AY146728-1|AAO12088.1| 131|Anopheles gambiae odorant-binding protein AgamOBP21 protein. Length = 131 Score = 23.8 bits (49), Expect = 3.5 Identities = 10/24 (41%), Positives = 15/24 (62%), Gaps = 4/24 (16%) Query: 132 FADIL----GRYDCDQAYSVHSCY 151 FAD+ G CD+A+S++ CY Sbjct: 100 FADVCENNEGETACDKAFSLYQCY 123 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.320 0.135 0.427 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,230 Number of Sequences: 2123 Number of extensions: 4330 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 2 length of query: 197 length of database: 516,269 effective HSP length: 61 effective length of query: 136 effective length of database: 386,766 effective search space: 52600176 effective search space used: 52600176 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -