BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001440-TA|BGIBMGA001440-PA|undefined (129 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 27 0.27 AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7... 24 1.4 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 26.6 bits (56), Expect = 0.27 Identities = 16/47 (34%), Positives = 21/47 (44%) Query: 36 RVRPFSGADSSPATTEAYTREYVRTSLATIPFRTCLWDPLEYSYPVL 82 R+ + S PA YT + SL F T L D ++ YPVL Sbjct: 495 RIDGVNAIQSDPADKLHYTARHPIGSLKRFGFHTYLIDMVQGPYPVL 541 >AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7 protein. Length = 696 Score = 24.2 bits (50), Expect = 1.4 Identities = 13/30 (43%), Positives = 16/30 (53%) Query: 37 VRPFSGADSSPATTEAYTREYVRTSLATIP 66 + FS A ++PA T A T R SL IP Sbjct: 50 INRFSAAAAAPAGTSADTPTMNRVSLNNIP 79 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.316 0.131 0.400 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,341 Number of Sequences: 2123 Number of extensions: 4331 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 129 length of database: 516,269 effective HSP length: 57 effective length of query: 72 effective length of database: 395,258 effective search space: 28458576 effective search space used: 28458576 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -