BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001439-TA|BGIBMGA001439-PA|undefined (195 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1633| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_31822| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_14676| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_58000| Best HMM Match : MATH (HMM E-Value=1.1e-19) 29 1.9 SB_51200| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_8572| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17) 29 2.5 SB_2895| Best HMM Match : RnaseH (HMM E-Value=3.1) 29 2.5 SB_42289| Best HMM Match : RVT_1 (HMM E-Value=5.2e-17) 29 2.5 SB_34611| Best HMM Match : rve (HMM E-Value=6.6e-22) 29 2.5 SB_27267| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17) 29 2.5 SB_27043| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_41962| Best HMM Match : RVT_1 (HMM E-Value=1.4e-18) 29 3.4 SB_37239| Best HMM Match : RVT_1 (HMM E-Value=6.4e-19) 29 3.4 SB_17208| Best HMM Match : RVT_1 (HMM E-Value=6.4e-19) 29 3.4 SB_14466| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_50204| Best HMM Match : rve (HMM E-Value=6.6e-22) 29 3.4 SB_27075| Best HMM Match : rve (HMM E-Value=1.5e-16) 29 3.4 SB_13654| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_53461| Best HMM Match : Amelogenin (HMM E-Value=0.099) 28 5.9 SB_51018| Best HMM Match : RVT_1 (HMM E-Value=5.8e-17) 28 5.9 SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) 28 5.9 SB_53148| Best HMM Match : rve (HMM E-Value=4.8e-21) 27 7.7 SB_47242| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) 27 7.7 SB_44206| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_31616| Best HMM Match : rve (HMM E-Value=6.9e-21) 27 7.7 SB_28476| Best HMM Match : RVT_1 (HMM E-Value=1.1e-19) 27 7.7 SB_24272| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) 27 7.7 SB_17257| Best HMM Match : rve (HMM E-Value=8.3e-08) 27 7.7 SB_6769| Best HMM Match : rve (HMM E-Value=3.5e-19) 27 7.7 SB_4272| Best HMM Match : RVT_1 (HMM E-Value=2e-28) 27 7.7 SB_1718| Best HMM Match : I-set (HMM E-Value=3.8e-07) 27 7.7 SB_59670| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_50912| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) 27 7.7 SB_47642| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) 27 7.7 SB_39940| Best HMM Match : Mnd1 (HMM E-Value=4.5e-16) 27 7.7 SB_34858| Best HMM Match : RVT_1 (HMM E-Value=2.9e-19) 27 7.7 SB_32461| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) 27 7.7 SB_22228| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) 27 7.7 SB_10467| Best HMM Match : zf-PARP (HMM E-Value=5.6e-35) 27 7.7 SB_2465| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_1625| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 >SB_1633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 40.7 bits (91), Expect = 8e-04 Identities = 34/155 (21%), Positives = 67/155 (43%), Gaps = 10/155 (6%) Query: 13 NFLIENYEKESRLRAKWFNLHKEKIEKCATL-KVDTKNYTHSDIAEATMIS---GMEAIT 68 NF E+ KE+ +R W + ++ + A + K + +A T+ S ++ Sbjct: 13 NFWKESINKEAYVRLNWHARYSKEFSRSAYVPKPRKEGMVIKPVASLTLPSKKLDSTTVS 72 Query: 69 RDHVSAVIHRFR---KPVPDYLLAKVETVRKIQPPMIAATSSEKDILKESKKSYLNMRNK 125 + + I +F K P+ LL ++ V ++ S L E + YL R Sbjct: 73 KTKLQDSIAQFEAAAKEDPNSLLIEMRPVSSNTKKLLYNGFSA---LGEGRYQYLEKRKM 129 Query: 126 RGPDDKYLYMESENWKYGWKLNESELKLRGPEHGK 160 + P+ KY + + W+ GWK++E ++ + G+ Sbjct: 130 KKPEQKYEFPITSAWEIGWKIDEYCPTMKAAQFGR 164 >SB_31822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 29.9 bits (64), Expect = 1.5 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Query: 92 ETVRKIQPPMIAATSSEKDILKESKKS-YLNMRNKRGPDDKYLYMESENWKYGWKLNESE 150 + VRK Q P + ATS K K+ K L++R + + +S + W N Sbjct: 85 QAVRKRQTPPLFATSDAKRSKKDDKDGCILDLRQRCDEHLIDMGQKSRVHGFSWARNSVF 144 Query: 151 LKLRGPE 157 + +RGPE Sbjct: 145 MAVRGPE 151 >SB_14676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 905 Score = 29.5 bits (63), Expect = 1.9 Identities = 19/61 (31%), Positives = 36/61 (59%), Gaps = 5/61 (8%) Query: 118 SYLNMRNKRGPDDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPD 177 SY++ +++ ++ + +E + G K N S++KLR E ++++ H L S+ G QPD Sbjct: 531 SYMHKTSQKWMENCLMVLERSR-EVGLKFNPSKVKLRVDE---VSYVGHRLTSQ-GLQPD 585 Query: 178 P 178 P Sbjct: 586 P 586 >SB_58000| Best HMM Match : MATH (HMM E-Value=1.1e-19) Length = 1451 Score = 29.5 bits (63), Expect = 1.9 Identities = 19/61 (31%), Positives = 36/61 (59%), Gaps = 5/61 (8%) Query: 118 SYLNMRNKRGPDDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPD 177 SY++ +++ ++ + +E + G K N S++KLR E ++++ H L S+ G QPD Sbjct: 531 SYMHKTSQKWMENCLMVLERSR-EVGLKFNPSKVKLRVDE---VSYVGHRLTSQ-GLQPD 585 Query: 178 P 178 P Sbjct: 586 P 586 >SB_51200| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 938 Score = 29.1 bits (62), Expect = 2.5 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 DDK + + + + G K N + KLR PE + HL + G +PDP Sbjct: 285 DDKMIAVLKRSREIGLKFNPRKAKLRVPEVSYVGHLF----TADGLKPDP 330 >SB_8572| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17) Length = 1432 Score = 29.1 bits (62), Expect = 2.5 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 DDK + + + + G K N + KLR PE + HL + G +PDP Sbjct: 501 DDKMIAVLKRSREIGLKFNPRKAKLRVPEVSYVGHLF----TADGLKPDP 546 >SB_2895| Best HMM Match : RnaseH (HMM E-Value=3.1) Length = 342 Score = 29.1 bits (62), Expect = 2.5 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 DDK + + + + G K N + KLR PE + HL + G +PDP Sbjct: 72 DDKMIAVLKRSREIGLKFNPRKAKLRVPEVSYVGHLF----TADGLKPDP 117 >SB_42289| Best HMM Match : RVT_1 (HMM E-Value=5.2e-17) Length = 429 Score = 29.1 bits (62), Expect = 2.5 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 DDK + + + + G K N + KLR PE + HL + G +PDP Sbjct: 239 DDKMIAVLKRSREIGLKFNPRKAKLRVPEVSYVGHLF----TADGLKPDP 284 >SB_34611| Best HMM Match : rve (HMM E-Value=6.6e-22) Length = 875 Score = 29.1 bits (62), Expect = 2.5 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 DDK + + + + G K N + KLR PE + HL + G +PDP Sbjct: 154 DDKMIAVLKRSREIGLKFNPRKAKLRVPEVSYVGHLF----TADGLKPDP 199 >SB_27267| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17) Length = 649 Score = 29.1 bits (62), Expect = 2.5 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 DDK + + + + G K N + KLR PE + HL + G +PDP Sbjct: 557 DDKMIAVLKRSREIGLKFNPRKAKLRVPEVSYVGHLF----TADGLKPDP 602 >SB_27043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 29.1 bits (62), Expect = 2.5 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 DDK + + + + G K N + KLR PE + HL + G +PDP Sbjct: 95 DDKMIAVLKRSREIGLKFNPRKAKLRVPEVSYVGHLF----TADGLKPDP 140 >SB_41962| Best HMM Match : RVT_1 (HMM E-Value=1.4e-18) Length = 1052 Score = 28.7 bits (61), Expect = 3.4 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 D+K + + + G K N S++KLR E ++++ H L S+ G QPDP Sbjct: 333 DEKLSMVLERSREVGLKFNPSKVKLRVDE---VSYVGHRLTSQ-GLQPDP 378 >SB_37239| Best HMM Match : RVT_1 (HMM E-Value=6.4e-19) Length = 690 Score = 28.7 bits (61), Expect = 3.4 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 D+K + + + G K N S++KLR E ++++ H L S+ G QPDP Sbjct: 333 DEKLSMVLERSREVGLKFNPSKVKLRVDE---VSYVGHRLTSQ-GLQPDP 378 >SB_17208| Best HMM Match : RVT_1 (HMM E-Value=6.4e-19) Length = 1053 Score = 28.7 bits (61), Expect = 3.4 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 D+K + + + G K N S++KLR E ++++ H L S+ G QPDP Sbjct: 819 DEKLSMVLERSREVGLKFNPSKVKLRVDE---VSYVGHRLTSQ-GLQPDP 864 >SB_14466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1052 Score = 28.7 bits (61), Expect = 3.4 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 D+K + + + G K N S++KLR E ++++ H L S+ G QPDP Sbjct: 333 DEKLSMVLERSREVGLKFNPSKVKLRVDE---VSYVGHRLTSQ-GLQPDP 378 >SB_50204| Best HMM Match : rve (HMM E-Value=6.6e-22) Length = 800 Score = 28.7 bits (61), Expect = 3.4 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDPV 179 DDK + + + + G K N + KLR PE + HL + P P+ V Sbjct: 333 DDKMIAVLKRSREIGLKFNPRKAKLRVPEVSYVGHLF--TADGLXPDPEKV 381 >SB_27075| Best HMM Match : rve (HMM E-Value=1.5e-16) Length = 656 Score = 28.7 bits (61), Expect = 3.4 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 D+K + + + G K N S++KLR E ++++ H L S+ G QPDP Sbjct: 28 DEKLSMVLERSREVGLKFNPSKVKLRVDE---VSYVGHRLTSQ-GLQPDP 73 >SB_13654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1451 Score = 28.7 bits (61), Expect = 3.4 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 D+K + + + G K N S++KLR K++++ H L S+ G QPDP Sbjct: 488 DEKLSMVLERSREVGLKFNPSKVKLR---VDKVSYVGHRLTSQ-GLQPDP 533 >SB_53461| Best HMM Match : Amelogenin (HMM E-Value=0.099) Length = 2489 Score = 27.9 bits (59), Expect = 5.9 Identities = 25/91 (27%), Positives = 39/91 (42%), Gaps = 11/91 (12%) Query: 85 DYLLAKVETVRKIQPPMIAATSSEKDIL-KESKKSYLNMRNKRGPDDKYLYMESENWKYG 143 D+ +A E +P A +S +++ KES+KS G D+ + W Sbjct: 547 DFEMASWEQHASFEPGRKAPSSKVAEVINKESRKS-------SGESDRRI---ENQWSAF 596 Query: 144 WKLNESELKLRGPEHGKINHLLHSLVSRVGP 174 ESE + GP HG I ++L+S P Sbjct: 597 SSSKESEDVVCGPSHGSIEKEGYTLISDENP 627 >SB_51018| Best HMM Match : RVT_1 (HMM E-Value=5.8e-17) Length = 635 Score = 27.9 bits (59), Expect = 5.9 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 D K + + + K G K N + KLR PE + HL + G +PDP Sbjct: 333 DHKMIAVLKRSRKIGLKFNPRKAKLRVPEVSYVGHLF----TADGLKPDP 378 >SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) Length = 917 Score = 27.9 bits (59), Expect = 5.9 Identities = 10/37 (27%), Positives = 24/37 (64%) Query: 112 LKESKKSYLNMRNKRGPDDKYLYMESENWKYGWKLNE 148 +K +++ + ++R + GP++ Y S N++YGW + + Sbjct: 675 VKYTERLHKHIRPENGPNEIYDRKISTNYEYGWWMRD 711 >SB_53148| Best HMM Match : rve (HMM E-Value=4.8e-21) Length = 1329 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 D K + + + + G K N ++KLR PE + H+ S G +PDP Sbjct: 624 DRKMIAVLERSREVGLKFNPKKIKLRVPEVSYVGHVFTS----EGLKPDP 669 >SB_47242| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) Length = 450 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 D K + + + + G K N ++KLR PE + H+ S G +PDP Sbjct: 314 DRKMIAVLERSREVGLKFNPKKIKLRVPEVSYVGHVFTS----EGLKPDP 359 >SB_44206| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 770 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 D K + + + + G K N ++KLR PE + H+ S G +PDP Sbjct: 154 DRKMIAVLERSREVGLKFNPKKIKLRVPEVSYVGHVFTS----EGLKPDP 199 >SB_31616| Best HMM Match : rve (HMM E-Value=6.9e-21) Length = 1183 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 D K + + + + G K N ++KLR PE + H+ S G +PDP Sbjct: 463 DRKMIAVLERSREVGLKFNPKKIKLRVPEVSYVGHVFTS----EGLKPDP 508 >SB_28476| Best HMM Match : RVT_1 (HMM E-Value=1.1e-19) Length = 332 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 D K + + + + G K N ++KLR PE + H+ S G +PDP Sbjct: 239 DRKMIAVLERSREVGLKFNPKKIKLRVPEVSYVGHVFTS----EGLKPDP 284 >SB_24272| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) Length = 1197 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 D K + + + + G K N ++KLR PE + H+ S G +PDP Sbjct: 477 DRKMIAVLERSREVGLKFNPKKIKLRVPEVSYVGHVFTS----EGLKPDP 522 >SB_17257| Best HMM Match : rve (HMM E-Value=8.3e-08) Length = 962 Score = 27.5 bits (58), Expect = 7.7 Identities = 30/135 (22%), Positives = 52/135 (38%), Gaps = 10/135 (7%) Query: 17 ENYEKESRLRAKWFNLHKEKIEKCATLKVDTKNYTHSDIAEATMISGMEAITRDHVSAVI 76 E +EK + K LH + K T++ D+ NY + +T DH Sbjct: 617 EAFEKIKMMITKAPVLHYYDVNKEVTIESDSSNYKPGPTMYLSDSLSRGTLTLDHA---- 672 Query: 77 HRFRKPVPDYLLAKVETVRKIQPPMIAATSSEKDILKESKKSYLNMRNKRGPDDKYLYME 136 R P Y + ++ KI P I +K + ++ N+R + D + Sbjct: 673 ---RPDTPAYQIFQISEEEKI-PEEIEDIDMQKSMFVTDER-LDNIRRETAKDPSLQTLM 727 Query: 137 SENWKYGWKLNESEL 151 + K GW N++E+ Sbjct: 728 TVT-KQGWPENKAEV 741 >SB_6769| Best HMM Match : rve (HMM E-Value=3.5e-19) Length = 577 Score = 27.5 bits (58), Expect = 7.7 Identities = 17/34 (50%), Positives = 20/34 (58%), Gaps = 4/34 (11%) Query: 145 KLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 KLN +LKLR PE I HLL + G +PDP Sbjct: 66 KLNPKKLKLRLPEVPYIGHLL----TPGGVKPDP 95 >SB_4272| Best HMM Match : RVT_1 (HMM E-Value=2e-28) Length = 876 Score = 27.5 bits (58), Expect = 7.7 Identities = 17/34 (50%), Positives = 20/34 (58%), Gaps = 4/34 (11%) Query: 145 KLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 KLN +LKLR PE I HLL + G +PDP Sbjct: 289 KLNPKKLKLRLPEVPYIGHLL----TPGGVKPDP 318 >SB_1718| Best HMM Match : I-set (HMM E-Value=3.8e-07) Length = 1017 Score = 27.5 bits (58), Expect = 7.7 Identities = 17/34 (50%), Positives = 20/34 (58%), Gaps = 4/34 (11%) Query: 145 KLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 KLN +LKLR PE I HLL + G +PDP Sbjct: 643 KLNPKKLKLRLPEVPYIGHLL----TPGGVKPDP 672 >SB_59670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 746 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 D K + + + + G K N ++KLR PE + H+ S G +PDP Sbjct: 419 DRKMIAVLERSREVGLKFNPKKIKLRVPEVSYVGHVFTS----EGLKPDP 464 >SB_50912| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) Length = 302 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 D K + + + + G K N ++KLR PE + H+ S G +PDP Sbjct: 154 DRKMIAVLERSREVGLKFNPKKIKLRVPEVSYVGHVFTS----EGLKPDP 199 >SB_47642| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) Length = 1336 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 D K + + + + G K N ++KLR PE + H+ S G +PDP Sbjct: 561 DRKMIAVLERSREVGLKFNPKKIKLRVPEVSYVGHVFTS----EGLKPDP 606 >SB_39940| Best HMM Match : Mnd1 (HMM E-Value=4.5e-16) Length = 179 Score = 27.5 bits (58), Expect = 7.7 Identities = 22/98 (22%), Positives = 44/98 (44%), Gaps = 3/98 (3%) Query: 20 EKESRLRAKWFNLHKEKIEKCATLKVDTKNYTHSDIAEATM--ISGMEAITRDHVSAVIH 77 EK RL+ +F K KI++ +T D + S + + E+ R+ + + Sbjct: 43 EKRHRLQELFFEKRKRKIDELSTAVADYEKKISSSSKQIKQANVGREESENRESLLQQLA 102 Query: 78 RFRKPVPDYLLAKVETVRKIQPPMIAATSSEKDILKES 115 ++ + L A++ET R+ P ++ E + KE+ Sbjct: 103 D-KEELCHKLEAELETYRECDPDVLDKLQQETAVAKEA 139 >SB_34858| Best HMM Match : RVT_1 (HMM E-Value=2.9e-19) Length = 201 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 D K + + + + G K N ++KLR PE + H+ S G +PDP Sbjct: 154 DRKMIAVLERSREVGLKFNPKKIKLRVPEVSYVGHVFTS----EGLKPDP 199 >SB_32461| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) Length = 320 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 D K + + + + G K N ++KLR PE + H+ S G +PDP Sbjct: 273 DRKMIAVLERSREVGLKFNPKKIKLRVPEVSYVGHVFTS----EGLKPDP 318 >SB_22228| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) Length = 302 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 D K + + + + G K N ++KLR PE + H+ S G +PDP Sbjct: 154 DRKMIAVLERSREVGLKFNPKKIKLRVPEVSYVGHVFTS----EGLKPDP 199 >SB_10467| Best HMM Match : zf-PARP (HMM E-Value=5.6e-35) Length = 1311 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 D K + + + + G K N ++KLR PE + H+ S G +PDP Sbjct: 878 DRKVIAVLERSREVGLKFNPKKIKLRVPEVSYVGHVFTS----EGLKPDP 923 >SB_2465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 129 DDKYLYMESENWKYGWKLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 D K + + + + G K N ++KLR PE + H+ S G +PDP Sbjct: 196 DRKMIAVLERSREVGLKFNPKKIKLRVPEISYVGHVFTS----EGLKPDP 241 >SB_1625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1018 Score = 27.5 bits (58), Expect = 7.7 Identities = 17/34 (50%), Positives = 20/34 (58%), Gaps = 4/34 (11%) Query: 145 KLNESELKLRGPEHGKINHLLHSLVSRVGPQPDP 178 KLN +LKLR PE I HLL + G +PDP Sbjct: 452 KLNPKKLKLRLPEVPYIGHLL----TPGGVKPDP 481 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.316 0.133 0.400 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,915,625 Number of Sequences: 59808 Number of extensions: 266303 Number of successful extensions: 809 Number of sequences better than 10.0: 41 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 31 Number of HSP's that attempted gapping in prelim test: 792 Number of HSP's gapped (non-prelim): 48 length of query: 195 length of database: 16,821,457 effective HSP length: 78 effective length of query: 117 effective length of database: 12,156,433 effective search space: 1422302661 effective search space used: 1422302661 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -