BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001434-TA|BGIBMGA001434-PA|undefined (110 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3H8.05c |||conserved fungal protein|Schizosaccharomyces pomb... 24 4.8 SPAC20G8.06 |||CCR4-Not complex subunit Not1 |Schizosaccharomyce... 24 6.3 >SPAC3H8.05c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1073 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/33 (30%), Positives = 20/33 (60%) Query: 1 MSEFHDQDSLEIYLLTIMNMVSSLYMDPSIGNY 33 M++ HD +++E+ + +NM +Y SIG + Sbjct: 858 MNKDHDSNAIELRNVITINMKDPIYSVCSIGKH 890 >SPAC20G8.06 |||CCR4-Not complex subunit Not1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2100 Score = 23.8 bits (49), Expect = 6.3 Identities = 8/23 (34%), Positives = 15/23 (65%) Query: 1 MSEFHDQDSLEIYLLTIMNMVSS 23 M EF D D L ++L+ +++ + S Sbjct: 562 MLEFEDADGLNVFLVEVLDFLMS 584 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.319 0.132 0.405 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 421,686 Number of Sequences: 5004 Number of extensions: 10935 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 15 Number of HSP's gapped (non-prelim): 2 length of query: 110 length of database: 2,362,478 effective HSP length: 64 effective length of query: 46 effective length of database: 2,042,222 effective search space: 93942212 effective search space used: 93942212 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -