BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001433-TA|BGIBMGA001433-PA|undefined (73 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024771-10|AAK70664.1| 433|Caenorhabditis elegans Hypothetical... 29 0.30 Z70038-1|CAA93884.1| 2219|Caenorhabditis elegans Hypothetical pr... 25 6.5 >AC024771-10|AAK70664.1| 433|Caenorhabditis elegans Hypothetical protein Y40B10A.9 protein. Length = 433 Score = 29.5 bits (63), Expect = 0.30 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 7/58 (12%) Query: 17 SLFKLLLFQMLVAWCDAKHVWTDD-MTRVELGSDDVNREVQDSIDTFMHTVELQPSML 73 S+F L+F WC +H+ DD +TR+E + + + +D D +M + LQ S L Sbjct: 8 SIFLFLVFATSATWC--QHIHNDDYLTRIE---EKLTTD-RDFYDQWMELITLQNSQL 59 >Z70038-1|CAA93884.1| 2219|Caenorhabditis elegans Hypothetical protein ZK1067.2 protein. Length = 2219 Score = 25.0 bits (52), Expect = 6.5 Identities = 11/36 (30%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Query: 9 LNKMEVRCSLFKLLLFQMLVAWCDA-KHVWTDDMTR 43 LN ++ SL +L + + + WCDA + + T+++ R Sbjct: 1146 LNDIKYIFSLARLKRWSLYITWCDALRSIVTENLPR 1181 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.324 0.132 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,581,274 Number of Sequences: 27539 Number of extensions: 48121 Number of successful extensions: 158 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 157 Number of HSP's gapped (non-prelim): 3 length of query: 73 length of database: 12,573,161 effective HSP length: 53 effective length of query: 20 effective length of database: 11,113,594 effective search space: 222271880 effective search space used: 222271880 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -