GeneModel BLAST Result against uniref50

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001433-TA|BGIBMGA001433-PA|undefined
         (73 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q754T5 Cluster: AFL014Cp; n=2; Saccharomycetaceae|Rep: ...    31   6.0  

>UniRef50_Q754T5 Cluster: AFL014Cp; n=2; Saccharomycetaceae|Rep:
           AFL014Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 557

 Score = 30.7 bits (66), Expect = 6.0
 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 36  VWTDDMTRVELGSDDVNREVQDSIDTFMHTVELQPSM 72
           VW++D   + +G DD N E+ D ++T  H   ++ S+
Sbjct: 270 VWSNDDCHISIGKDDGNTEIWD-VETMSHVRTMRSSL 305


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.324    0.132    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 68,116,004
Number of Sequences: 1657284
Number of extensions: 1968417
Number of successful extensions: 6025
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 6025
Number of HSP's gapped (non-prelim): 1
length of query: 73
length of database: 575,637,011
effective HSP length: 52
effective length of query: 21
effective length of database: 489,458,243
effective search space: 10278623103
effective search space used: 10278623103
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 65 (30.3 bits)