BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001431-TA|BGIBMGA001431-PA|IPR011021|Arrestin, N-terminal, IPR011022|Arrestin, C-terminal (286 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 23 3.4 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 4.6 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 22.6 bits (46), Expect = 3.4 Identities = 6/26 (23%), Positives = 16/26 (61%) Query: 4 KEANIYLDNQWNTYYAGQTVNGRIEY 29 K ++Y +QW + + + ++ ++EY Sbjct: 320 KNTHMYKGDQWVAFDSPKAISNKVEY 345 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 22.2 bits (45), Expect = 4.6 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Query: 203 IDIENKSNVQLHLVKIFLRKVVTYRATSPSSATKKIKDVILTLQEG 248 + IEN H +K KV+ R T S +TK+ + TL G Sbjct: 759 LQIENVEQTLNHEIK----KVIPGRITQKSCSTKRYVTPVNTLVRG 800 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.135 0.411 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 75,782 Number of Sequences: 317 Number of extensions: 3610 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 2 length of query: 286 length of database: 114,650 effective HSP length: 56 effective length of query: 230 effective length of database: 96,898 effective search space: 22286540 effective search space used: 22286540 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -