GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001431-TA|BGIBMGA001431-PA|IPR011021|Arrestin,
N-terminal, IPR011022|Arrestin, C-terminal
         (286 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY347952-1|AAR28375.1|  634|Anopheles gambiae putative sulfakini...    24   4.3  
AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein.       24   4.3  

>AY347952-1|AAR28375.1|  634|Anopheles gambiae putative sulfakinin
           GPCR protein.
          Length = 634

 Score = 24.2 bits (50), Expect = 4.3
 Identities = 7/7 (100%), Positives = 7/7 (100%)

Query: 173 CCFCCAS 179
           CCFCCAS
Sbjct: 549 CCFCCAS 555


>AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein.
          Length = 1009

 Score = 24.2 bits (50), Expect = 4.3
 Identities = 10/31 (32%), Positives = 15/31 (48%)

Query: 147 TVINALDLNLNPSYKEPIHIQLEKTFCCFCC 177
           T IN++ +  N +  E    QL +  CC  C
Sbjct: 158 TFINSIGIQCNTTCPEGFEAQLSEQHCCPQC 188


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.317    0.135    0.411 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 321,374
Number of Sequences: 2123
Number of extensions: 13581
Number of successful extensions: 31
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 29
Number of HSP's gapped (non-prelim): 2
length of query: 286
length of database: 516,269
effective HSP length: 63
effective length of query: 223
effective length of database: 382,520
effective search space: 85301960
effective search space used: 85301960
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 47 (23.0 bits)