BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001430-TA|BGIBMGA001430-PA|undefined (840 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 29 0.13 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 27 0.40 AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 23 8.6 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 29.1 bits (62), Expect = 0.13 Identities = 16/47 (34%), Positives = 23/47 (48%) Query: 654 LMLKQERPTADVVRQLFCRTYDEEDTSVVSTLMYWCQDYEDKVGDLV 700 L+LK+ P AD+ L+ R +DT + +L W DK LV Sbjct: 681 LLLKEFDPWADLDNNLYERVTSLKDTKAILSLGGWTDSAGDKYSRLV 727 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 27.5 bits (58), Expect = 0.40 Identities = 14/51 (27%), Positives = 21/51 (41%) Query: 234 RSHPAVTATLLDFLCRIIPNFYPPYAEKVRQGIFNSLQQIIEKRVLPNLHP 284 R +T+ + P YPP A+ V FNS+ V+ L+P Sbjct: 274 RLRKQITSAATPLVRSYAPERYPPLAQGVNDDAFNSVATPTPTSVMTELYP 324 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 23.0 bits (47), Expect = 8.6 Identities = 16/65 (24%), Positives = 27/65 (41%), Gaps = 2/65 (3%) Query: 15 LICMVVYTYLRLVEDHNIPQLMNLRQKEVNFVITLIRERFTDVLSLGRDLVRLLQNVARI 74 LI + T + LV H + L +R + F + R DV+ Q + R+ Sbjct: 160 LITRKLATLMALVTAHRVQTLAAIRINNILFSAEGVEIRIPDVIKTSGP--HKFQPLLRL 217 Query: 75 PEFNQ 79 P+F + Sbjct: 218 PKFKK 222 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.134 0.398 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,047 Number of Sequences: 317 Number of extensions: 7992 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 3 length of query: 840 length of database: 114,650 effective HSP length: 63 effective length of query: 777 effective length of database: 94,679 effective search space: 73565583 effective search space used: 73565583 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -