BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001429-TA|BGIBMGA001429-PA|undefined (61 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47261| Best HMM Match : HA2 (HMM E-Value=5.8e-16) 25 6.7 SB_24047| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 8.8 >SB_47261| Best HMM Match : HA2 (HMM E-Value=5.8e-16) Length = 351 Score = 25.4 bits (53), Expect = 6.7 Identities = 11/17 (64%), Positives = 12/17 (70%) Query: 35 DPELCIAAGLSPLSTWT 51 DP + IAAGLS S WT Sbjct: 160 DPVMIIAAGLSVQSPWT 176 >SB_24047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2905 Score = 25.0 bits (52), Expect = 8.8 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 22 VVTRIPLFKDGGVDPELCIAAGLSPLST-WTMTE 54 VVTR PLF G V LC + L+ WTM + Sbjct: 1500 VVTRAPLFYLGNVFSNLCRSIVLAHRGRYWTMLQ 1533 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.324 0.137 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,924,565 Number of Sequences: 59808 Number of extensions: 53532 Number of successful extensions: 93 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 92 Number of HSP's gapped (non-prelim): 2 length of query: 61 length of database: 16,821,457 effective HSP length: 40 effective length of query: 21 effective length of database: 14,429,137 effective search space: 303011877 effective search space used: 303011877 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -