BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001429-TA|BGIBMGA001429-PA|undefined (61 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein p... 20 7.5 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 20 7.5 >AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein protein. Length = 429 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/21 (33%), Positives = 15/21 (71%) Query: 34 VDPELCIAAGLSPLSTWTMTE 54 VD +L +AG++ +S W +++ Sbjct: 300 VDRKLQASAGVTKVSMWQLSD 320 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 20.2 bits (40), Expect = 7.5 Identities = 8/37 (21%), Positives = 18/37 (48%) Query: 9 RSTRGLPRVVIATVVTRIPLFKDGGVDPELCIAAGLS 45 R+ + + V + + + +P+ D E C +G+S Sbjct: 795 RAYKTISHVAVCVIASMVPICLILAEDSECCSFSGVS 831 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.324 0.137 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 57,814 Number of Sequences: 2123 Number of extensions: 1588 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 61 length of database: 516,269 effective HSP length: 40 effective length of query: 21 effective length of database: 431,349 effective search space: 9058329 effective search space used: 9058329 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (21.1 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -