BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001426-TA|BGIBMGA001426-PA|IPR004344|Tubulin-tyrosine ligase (636 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 27 1.5 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 26 2.7 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 27.1 bits (57), Expect = 1.5 Identities = 12/30 (40%), Positives = 17/30 (56%) Query: 306 YILEVNHSPSFHTDTQLDREVKENLLTDTF 335 Y + +H T +LDREV E ++TD F Sbjct: 380 YQVVTSHLRGSRTPPELDREVLERIVTDLF 409 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 26.2 bits (55), Expect = 2.7 Identities = 22/92 (23%), Positives = 44/92 (47%), Gaps = 5/92 (5%) Query: 321 QLDREVKENLLTDTFTMLNIWQCDKKRVLEEDRKRIRDRLLQTNKYAETTTIDEKDREKT 380 QL R+ K+ L+ + L + + + +R E+DR + K A +DR +T Sbjct: 261 QLQRQRKQELIAEEQQSLEVIEGEMRRQQEQDRAALEASKEMRRKNALEAIRMAEDR-RT 319 Query: 381 PWQTQIQWEESHLGNFRRVYPVGEQYASLFQQ 412 + + + E++ L ++Y G+Q + F+Q Sbjct: 320 RLRRESEIEDALL----QIYCEGQQNIASFKQ 347 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.319 0.133 0.402 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 634,200 Number of Sequences: 2123 Number of extensions: 26747 Number of successful extensions: 90 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 88 Number of HSP's gapped (non-prelim): 3 length of query: 636 length of database: 516,269 effective HSP length: 68 effective length of query: 568 effective length of database: 371,905 effective search space: 211242040 effective search space used: 211242040 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -