BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001424-TA|BGIBMGA001424-PA|undefined (112 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 22 4.6 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 22.2 bits (45), Expect = 4.6 Identities = 13/60 (21%), Positives = 25/60 (41%) Query: 48 DSFGARAHPRRYRRPMPGAATCGHSAGSGTTRRATSRVIRTRALSRRAYETPLLLSLPTN 107 ++ + A P + +PG A + S + R+TS+ + PL+ +P N Sbjct: 588 NALASPASPLKSPSKIPGLARRPENISSESRSRSTSKQRANAKTPETPSDQPLIKEVPMN 647 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.326 0.134 0.404 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,221 Number of Sequences: 2123 Number of extensions: 2555 Number of successful extensions: 4 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 2 length of query: 112 length of database: 516,269 effective HSP length: 56 effective length of query: 56 effective length of database: 397,381 effective search space: 22253336 effective search space used: 22253336 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -