GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001424-TA|BGIBMGA001424-PA|undefined
         (112 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubu...    22   4.6  

>AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubule
           binding protein protein.
          Length = 838

 Score = 22.2 bits (45), Expect = 4.6
 Identities = 13/60 (21%), Positives = 25/60 (41%)

Query: 48  DSFGARAHPRRYRRPMPGAATCGHSAGSGTTRRATSRVIRTRALSRRAYETPLLLSLPTN 107
           ++  + A P +    +PG A    +  S +  R+TS+            + PL+  +P N
Sbjct: 588 NALASPASPLKSPSKIPGLARRPENISSESRSRSTSKQRANAKTPETPSDQPLIKEVPMN 647


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.326    0.134    0.404 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 89,221
Number of Sequences: 2123
Number of extensions: 2555
Number of successful extensions: 4
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2
Number of HSP's gapped (non-prelim): 2
length of query: 112
length of database: 516,269
effective HSP length: 56
effective length of query: 56
effective length of database: 397,381
effective search space: 22253336
effective search space used: 22253336
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.7 bits)
S2: 43 (21.4 bits)