BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001424-TA|BGIBMGA001424-PA|undefined (112 letters) Database: fruitfly 52,641 sequences; 24,830,863 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X97196-1|CAA65830.1| 3429|Drosophila melanogaster hypothetical p... 27 5.6 AE014298-856|AAF46135.2| 3419|Drosophila melanogaster CG3585-PA ... 27 5.6 BT011329-1|AAR96121.1| 1659|Drosophila melanogaster SD20887p pro... 27 7.3 AY058598-1|AAL13827.1| 950|Drosophila melanogaster LD29187p pro... 27 7.3 AE014134-1101|AAF52390.3| 1659|Drosophila melanogaster CG9537-PA... 27 7.3 AB062671-1|BAB78519.1| 1645|Drosophila melanogaster Daxx-like pr... 27 7.3 >X97196-1|CAA65830.1| 3429|Drosophila melanogaster hypothetical protein protein. Length = 3429 Score = 27.1 bits (57), Expect = 5.6 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query: 41 RAQHLEFDSFGARAHPRRYRRPMPGAATCGHSAGSGT 77 R +H++ F R H + +PGAA+ G ++G GT Sbjct: 336 RLKHMK-TCFHIRRHMKAGASAVPGAASAGAASGGGT 371 >AE014298-856|AAF46135.2| 3419|Drosophila melanogaster CG3585-PA protein. Length = 3419 Score = 27.1 bits (57), Expect = 5.6 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query: 41 RAQHLEFDSFGARAHPRRYRRPMPGAATCGHSAGSGT 77 R +H++ F R H + +PGAA+ G ++G GT Sbjct: 329 RLKHMK-TCFHIRRHMKAGASAVPGAASAGAASGGGT 364 >BT011329-1|AAR96121.1| 1659|Drosophila melanogaster SD20887p protein. Length = 1659 Score = 26.6 bits (56), Expect = 7.3 Identities = 19/63 (30%), Positives = 26/63 (41%), Gaps = 2/63 (3%) Query: 52 ARAHPRR--YRRPMPGAATCGHSAGSGTTRRATSRVIRTRALSRRAYETPLLLSLPTNSA 109 AR P R R+ T H G + R++ T A PLLL+LP ++ Sbjct: 870 ARTLPFRSSQRKTSEAPMTSTHVQGFTASATPPQRLLATPPHCAAALNEPLLLNLPPTTS 929 Query: 110 IRP 112 I P Sbjct: 930 ITP 932 >AY058598-1|AAL13827.1| 950|Drosophila melanogaster LD29187p protein. Length = 950 Score = 26.6 bits (56), Expect = 7.3 Identities = 19/63 (30%), Positives = 26/63 (41%), Gaps = 2/63 (3%) Query: 52 ARAHPRR--YRRPMPGAATCGHSAGSGTTRRATSRVIRTRALSRRAYETPLLLSLPTNSA 109 AR P R R+ T H G + R++ T A PLLL+LP ++ Sbjct: 161 ARTLPFRSSQRKTSEAPMTSTHVQGFTASATPPQRLLATPPHCAAALNEPLLLNLPPTTS 220 Query: 110 IRP 112 I P Sbjct: 221 ITP 223 >AE014134-1101|AAF52390.3| 1659|Drosophila melanogaster CG9537-PA protein. Length = 1659 Score = 26.6 bits (56), Expect = 7.3 Identities = 19/63 (30%), Positives = 26/63 (41%), Gaps = 2/63 (3%) Query: 52 ARAHPRR--YRRPMPGAATCGHSAGSGTTRRATSRVIRTRALSRRAYETPLLLSLPTNSA 109 AR P R R+ T H G + R++ T A PLLL+LP ++ Sbjct: 870 ARTLPFRSSQRKTSEAPMTSTHVQGFTASATPPQRLLATPPHCAAALNEPLLLNLPPTTS 929 Query: 110 IRP 112 I P Sbjct: 930 ITP 932 >AB062671-1|BAB78519.1| 1645|Drosophila melanogaster Daxx-like protein protein. Length = 1645 Score = 26.6 bits (56), Expect = 7.3 Identities = 19/63 (30%), Positives = 26/63 (41%), Gaps = 2/63 (3%) Query: 52 ARAHPRR--YRRPMPGAATCGHSAGSGTTRRATSRVIRTRALSRRAYETPLLLSLPTNSA 109 AR P R R+ T H G + R++ T A PLLL+LP ++ Sbjct: 856 ARTLPFRSSQRKTSEAPMTSTHVQGFTASATPPQRLLATPPHCAAALNEPLLLNLPPTTS 915 Query: 110 IRP 112 I P Sbjct: 916 ITP 918 Database: fruitfly Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 24,830,863 Number of sequences in database: 52,641 Lambda K H 0.326 0.134 0.404 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,343,148 Number of Sequences: 52641 Number of extensions: 139217 Number of successful extensions: 640 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 636 Number of HSP's gapped (non-prelim): 6 length of query: 112 length of database: 24,830,863 effective HSP length: 75 effective length of query: 37 effective length of database: 20,882,788 effective search space: 772663156 effective search space used: 772663156 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 55 (26.2 bits)
- SilkBase 1999-2023 -