BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001424-TA|BGIBMGA001424-PA|undefined (112 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U80441-11|AAB37660.3| 1037|Caenorhabditis elegans Hypothetical p... 27 4.0 Z70271-4|CAA94235.1| 1026|Caenorhabditis elegans Hypothetical pr... 26 7.0 >U80441-11|AAB37660.3| 1037|Caenorhabditis elegans Hypothetical protein F27C1.11 protein. Length = 1037 Score = 26.6 bits (56), Expect = 4.0 Identities = 16/46 (34%), Positives = 22/46 (47%) Query: 67 ATCGHSAGSGTTRRATSRVIRTRALSRRAYETPLLLSLPTNSAIRP 112 AT G+S+G+ +R I R +SRR E + S T S P Sbjct: 171 ATSGNSSGNSIEKRQPLPSINNRYVSRRPQENGVSNSTTTTSPYVP 216 >Z70271-4|CAA94235.1| 1026|Caenorhabditis elegans Hypothetical protein W08D2.7 protein. Length = 1026 Score = 25.8 bits (54), Expect = 7.0 Identities = 12/23 (52%), Positives = 14/23 (60%) Query: 58 RYRRPMPGAATCGHSAGSGTTRR 80 ++R M G AT G SAGS RR Sbjct: 328 KFRDAMSGLATAGDSAGSFNKRR 350 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.326 0.134 0.404 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,002,337 Number of Sequences: 27539 Number of extensions: 55865 Number of successful extensions: 176 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 174 Number of HSP's gapped (non-prelim): 2 length of query: 112 length of database: 12,573,161 effective HSP length: 72 effective length of query: 40 effective length of database: 10,590,353 effective search space: 423614120 effective search space used: 423614120 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -