BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001417-TA|BGIBMGA001417-PA|IPR002867|Zinc finger, C6HC-type, IPR001841|Zinc finger, RING-type (503 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 24 2.6 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 5.9 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 24.2 bits (50), Expect = 2.6 Identities = 11/45 (24%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Query: 421 YTYVFAYYLRKNNQSVIFEDNQRDLESATETLSEYLE-RDITSEN 464 Y Y + +N V+F+ N+ + ++ S+YL+ ++++ EN Sbjct: 142 YFYSKSNGSNSSNSDVLFKQNKEEEQTINRKNSDYLDNQEVSMEN 186 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.0 bits (47), Expect = 5.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Query: 71 PATTTRILLNHFKWDKEKLM 90 P T T LLN D EKLM Sbjct: 636 PPTLTESLLNRHNEDMEKLM 655 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.322 0.134 0.433 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,137 Number of Sequences: 429 Number of extensions: 7072 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 22 Number of HSP's gapped (non-prelim): 2 length of query: 503 length of database: 140,377 effective HSP length: 61 effective length of query: 442 effective length of database: 114,208 effective search space: 50479936 effective search space used: 50479936 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -