BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001414-TA|BGIBMGA001414-PA|undefined (235 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 22 4.7 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 6.3 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 8.3 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.8 bits (44), Expect = 4.7 Identities = 12/41 (29%), Positives = 18/41 (43%) Query: 130 ENLKKYSASKLFECQKQQQVGGNCSHESQDLERTVFLYETS 170 ++ K S +F C K + SHE Q+L + E S Sbjct: 296 DSAKSESQQTVFLCYKLMEKFPERSHEQQELYMAAQVIEKS 336 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.4 bits (43), Expect = 6.3 Identities = 11/31 (35%), Positives = 20/31 (64%) Query: 19 YRALIADIQVRTQKSREDMDTLVSQIKLLMK 49 +RA +A ++ RT+ + +D + S+ KL MK Sbjct: 537 WRAFLAVLKRRTEIYKGLIDRIKSREKLTMK 567 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.0 bits (42), Expect = 8.3 Identities = 11/43 (25%), Positives = 20/43 (46%) Query: 154 SHESQDLERTVFLYETSPFPVVMSEIAIHGFKEVSDLSVCLKD 196 +HE + ++T FL P P + +E+ DL V ++ Sbjct: 295 THEIKLHDKTPFLKRPYPVPFALRPAVDATIQEMLDLGVIKRE 337 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.134 0.379 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 48,650 Number of Sequences: 317 Number of extensions: 1885 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 3 length of query: 235 length of database: 114,650 effective HSP length: 55 effective length of query: 180 effective length of database: 97,215 effective search space: 17498700 effective search space used: 17498700 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -