GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001411-TA|BGIBMGA001411-PA|IPR000608|Ubiquitin-
conjugating enzyme, E2
         (353 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292376-1|CAL23188.2|  402|Tribolium castaneum gustatory recept...    22   5.8  

>AM292376-1|CAL23188.2|  402|Tribolium castaneum gustatory receptor
           candidate 55 protein.
          Length = 402

 Score = 22.2 bits (45), Expect = 5.8
 Identities = 12/45 (26%), Positives = 22/45 (48%), Gaps = 2/45 (4%)

Query: 168 YLSGSVSGSLQATDRLMKELRDIYRSHSFKNNM--YSIELVNDSL 210
           Y   S       T  ++ ELR+ Y     +NN+  YS++L++  +
Sbjct: 308 YACASTCEQANDTPSILHELRNNYFHMDLENNVQSYSLQLLHQKV 352


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.317    0.133    0.393 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 75,114
Number of Sequences: 317
Number of extensions: 2894
Number of successful extensions: 4
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 4
Number of HSP's gapped (non-prelim): 1
length of query: 353
length of database: 114,650
effective HSP length: 57
effective length of query: 296
effective length of database: 96,581
effective search space: 28587976
effective search space used: 28587976
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 44 (21.8 bits)