BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001409-TA|BGIBMGA001409-PA|undefined (69 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A5K845 Cluster: Putative uncharacterized protein; n=2; ... 31 4.6 UniRef50_A7T0T7 Cluster: Predicted protein; n=2; Nematostella ve... 30 8.0 >UniRef50_A5K845 Cluster: Putative uncharacterized protein; n=2; Plasmodium|Rep: Putative uncharacterized protein - Plasmodium vivax Length = 952 Score = 31.1 bits (67), Expect = 4.6 Identities = 15/44 (34%), Positives = 25/44 (56%) Query: 3 KGDESLERLIVVGNTEGKGHGAKHQLKGEEPPQKFYDVVTDVTD 46 K E E+ + GN +GK G + +L+ ++ PQ+ D V D +D Sbjct: 65 KQKEHKEKSLQNGNAKGKSSGREKKLRKKDAPQEDSDSVGDFSD 108 >UniRef50_A7T0T7 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 425 Score = 30.3 bits (65), Expect = 8.0 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Query: 4 GDESLERLIVVGNTEG-KGHGAKHQLKGEEPPQKFYDVVTDVTDRN 48 GD S +I+ T G +G KHQ K E+ P K+ ++ D D++ Sbjct: 168 GDTSNAWMILTRLTSGQRGKYKKHQKKAEQQPDKYPSLIIDGMDQS 213 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.315 0.137 0.424 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,191,729 Number of Sequences: 1657284 Number of extensions: 3152792 Number of successful extensions: 4295 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 4294 Number of HSP's gapped (non-prelim): 2 length of query: 69 length of database: 575,637,011 effective HSP length: 48 effective length of query: 21 effective length of database: 496,087,379 effective search space: 10417834959 effective search space used: 10417834959 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 65 (30.3 bits)
- SilkBase 1999-2023 -