BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001409-TA|BGIBMGA001409-PA|undefined (69 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF467287-1|AAM53530.1| 2851|Homo sapiens beige-like protein prot... 29 2.3 AF216648-1|AAG48558.2| 2863|Homo sapiens LPS responsive and Beig... 29 2.3 >AF467287-1|AAM53530.1| 2851|Homo sapiens beige-like protein protein. Length = 2851 Score = 29.1 bits (62), Expect = 2.3 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Query: 12 IVVGNTEGKGHGAKHQLKGEEPPQKFYDVVTDVTDRNGW 50 ++V + + KG G +H +K + PQK+Y +VT V N W Sbjct: 274 LIVTSIKSKGKGFQHCVKFDFKPQKWY-MVTIVHIYNRW 311 >AF216648-1|AAG48558.2| 2863|Homo sapiens LPS responsive and Beige-like anchor protein LRBA protein. Length = 2863 Score = 29.1 bits (62), Expect = 2.3 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Query: 12 IVVGNTEGKGHGAKHQLKGEEPPQKFYDVVTDVTDRNGW 50 ++V + + KG G +H +K + PQK+Y +VT V N W Sbjct: 274 LIVTSIKSKGKGFQHCVKFDFKPQKWY-MVTIVHIYNRW 311 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.315 0.137 0.424 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,255,865 Number of Sequences: 224733 Number of extensions: 381805 Number of successful extensions: 390 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 390 Number of HSP's gapped (non-prelim): 2 length of query: 69 length of database: 73,234,838 effective HSP length: 48 effective length of query: 21 effective length of database: 62,447,654 effective search space: 1311400734 effective search space used: 1311400734 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -