BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001405-TA|BGIBMGA001405-PA|undefined (324 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 23 2.7 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 22 6.3 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 23.4 bits (48), Expect = 2.7 Identities = 12/47 (25%), Positives = 20/47 (42%) Query: 248 LSAFSVPVRSNNGTPDKIFNQNKIGKANGTSYVMKNLKRVYDNLNNV 294 +S+ S NN +N N N + N K++Y N+ N+ Sbjct: 315 ISSLSNKTIHNNNNYKYNYNNNNYNNNNYNNNYNNNCKKLYYNIINI 361 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 22.2 bits (45), Expect = 6.3 Identities = 9/24 (37%), Positives = 13/24 (54%) Query: 53 SEMLRSFVNARHGCRPPHYQRRFK 76 + M +SFV H +PP Q + K Sbjct: 235 TSMAKSFVRKVHATKPPKPQTKTK 258 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.315 0.132 0.383 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,926 Number of Sequences: 429 Number of extensions: 3475 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 2 length of query: 324 length of database: 140,377 effective HSP length: 58 effective length of query: 266 effective length of database: 115,495 effective search space: 30721670 effective search space used: 30721670 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -