BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001405-TA|BGIBMGA001405-PA|undefined (324 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13980.1 68416.m01765 expressed protein 36 0.028 At3g28770.1 68416.m03591 expressed protein 33 0.26 At3g17160.1 68416.m02189 expressed protein 33 0.34 At5g63740.1 68418.m08000 zinc finger protein-related 31 0.79 At5g50310.1 68418.m06229 kelch repeat-containing protein similar... 31 1.4 At5g27590.1 68418.m03304 hypothetical protein 31 1.4 At5g44313.1 68418.m05425 hypothetical protein 30 1.8 At5g06420.2 68418.m00719 zinc finger (CCCH-type/C3HC4-type RING ... 30 1.8 At5g06420.1 68418.m00718 zinc finger (CCCH-type/C3HC4-type RING ... 30 1.8 At3g29000.1 68416.m03624 calcium-binding EF hand family protein ... 30 1.8 At1g76950.1 68414.m08958 zinc finger protein (PRAF1) / regulator... 30 1.8 At4g02510.1 68417.m00343 chloroplast outer membrane protein, put... 30 2.4 At3g45830.1 68416.m04960 expressed protein 30 2.4 At1g77030.1 68414.m08970 glycine-rich protein 30 2.4 At1g55400.1 68414.m06336 hypothetical protein 29 3.2 At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar... 29 3.2 At5g54260.1 68418.m06759 DNA repair and meiosis protein (Mre11) ... 29 4.2 At5g10510.1 68418.m01217 ovule development protein, putative sim... 29 4.2 At2g41880.1 68415.m05179 guanylate kinase 1 (GK-1) identical to ... 29 5.6 At1g47970.1 68414.m05343 expressed protein 29 5.6 At5g22840.1 68418.m02670 protein kinase family protein contains ... 28 7.4 At5g05740.2 68418.m00632 peptidase M50 family protein / sterol-r... 28 7.4 At5g05740.1 68418.m00631 peptidase M50 family protein / sterol-r... 28 7.4 At5g03950.1 68418.m00375 hypothetical protein 28 7.4 At5g02850.1 68418.m00228 hydroxyproline-rich glycoprotein family... 28 7.4 At3g60110.1 68416.m06712 DNA-binding bromodomain-containing prot... 28 7.4 At3g18390.1 68416.m02339 expressed protein contains Pfam domain,... 28 7.4 At2g31210.1 68415.m03811 basic helix-loop-helix (bHLH) family pr... 28 7.4 At1g75150.1 68414.m08729 expressed protein ; expression supporte... 28 7.4 At1g55600.1 68414.m06364 WRKY family transcription factor simila... 28 7.4 At5g40110.1 68418.m04865 hypothetical protein 28 9.7 At3g49410.1 68416.m05401 transcription factor-related contains w... 28 9.7 At3g28320.1 68416.m03538 hypothetical protein similar to At14a (... 28 9.7 At1g49920.1 68414.m05598 zinc finger protein-related weak simila... 28 9.7 At1g04500.1 68414.m00441 zinc finger CONSTANS-related similar to... 28 9.7 >At3g13980.1 68416.m01765 expressed protein Length = 357 Score = 36.3 bits (80), Expect = 0.028 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 6/73 (8%) Query: 249 SAFSVPVRSNNGTPDKIFNQNKIGKANGTSYVM---KNLKRVYDNLNNVRDTEGSKVNND 305 S+F++P NN +++++ N+ + V+ K+L R Y N N V T + V D Sbjct: 249 SSFTMPYAYNN---ERLYDNNEAKRVEEHRRVIQAAKDLLRTYHNKNKVTTTNINNVEED 305 Query: 306 DEDRDEKLESSDV 318 DED SSD+ Sbjct: 306 DEDDAASCASSDL 318 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/39 (38%), Positives = 21/39 (53%) Query: 279 YVMKNLKRVYDNLNNVRDTEGSKVNNDDEDRDEKLESSD 317 YV LK+ DN +E SK+ +++D EK ES D Sbjct: 966 YVNNELKKQEDNKKETTKSENSKLKEENKDNKEKKESED 1004 >At3g17160.1 68416.m02189 expressed protein Length = 165 Score = 32.7 bits (71), Expect = 0.34 Identities = 14/47 (29%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Query: 276 GTSYVMKNLKRVYDNLNNVRDTEGSKVNNDDEDRDEKLESSDVEDDV 322 GT Y+++ + V D ++ D + + D+E+ DE++E DV++D+ Sbjct: 84 GTEYLVRPVGEVEDE-DDASDFDPEENGLDEEEGDEEIEEDDVDEDI 129 >At5g63740.1 68418.m08000 zinc finger protein-related Length = 226 Score = 31.5 bits (68), Expect = 0.79 Identities = 13/36 (36%), Positives = 22/36 (61%) Query: 286 RVYDNLNNVRDTEGSKVNNDDEDRDEKLESSDVEDD 321 +VYD+ NN + +G + DED DE ++ + ED+ Sbjct: 50 KVYDDHNNDGEGDGDGDGDGDEDEDEDADADEDEDE 85 >At5g50310.1 68418.m06229 kelch repeat-containing protein similar to Kelch repeats protein 3 (SP:Q08979) [Saccharomyces cerevisiae]; contains Pfam PF01344: Kelch motif (6 repeats) Length = 666 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/27 (44%), Positives = 19/27 (70%) Query: 296 DTEGSKVNNDDEDRDEKLESSDVEDDV 322 + EG+ +DDED DE++E+ DV+ V Sbjct: 514 EDEGNSEESDDEDDDEEVEAMDVDGSV 540 >At5g27590.1 68418.m03304 hypothetical protein Length = 320 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/29 (44%), Positives = 17/29 (58%) Query: 296 DTEGSKVNNDDEDRDEKLESSDVEDDVID 324 D E +V+N DE+ + E DVEDD D Sbjct: 126 DAESDRVSNVDENNEAVYEQDDVEDDKTD 154 >At5g44313.1 68418.m05425 hypothetical protein Length = 237 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 5/42 (11%) Query: 283 NLKRVYDNLNNVRDTEGSKVNNDDEDRDEKLESSDVEDDVID 324 N+ R +D+ D E +V+N DE+ + E DVEDD D Sbjct: 81 NVSRAHDD-----DAESDRVSNVDENNEAVDEQDDVEDDKTD 117 >At5g06420.2 68418.m00719 zinc finger (CCCH-type/C3HC4-type RING finger) family protein contains Pfam domains PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) and PF00097: Zinc finger, C3HC4 type (RING finger) Length = 378 Score = 30.3 bits (65), Expect = 1.8 Identities = 21/99 (21%), Positives = 41/99 (41%) Query: 222 VAPDNVDVSQTDDPEKRLGRDFGRRHLSAFSVPVRSNNGTPDKIFNQNKIGKANGTSYVM 281 V +N+ S + +KR SA + S+ G D + N + G N + Sbjct: 5 VVKENIVASASSPMKKRRIDHTESADGSAINASNSSSIGGNDTVMNMAEFGNDNSNNQES 64 Query: 282 KNLKRVYDNLNNVRDTEGSKVNNDDEDRDEKLESSDVED 320 + + + ++ ++ D+ED D K ESS +++ Sbjct: 65 QQVCTFFKKPTKSKNIRKRTIDADEEDGDSKSESSILQN 103 >At5g06420.1 68418.m00718 zinc finger (CCCH-type/C3HC4-type RING finger) family protein contains Pfam domains PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) and PF00097: Zinc finger, C3HC4 type (RING finger) Length = 378 Score = 30.3 bits (65), Expect = 1.8 Identities = 21/99 (21%), Positives = 41/99 (41%) Query: 222 VAPDNVDVSQTDDPEKRLGRDFGRRHLSAFSVPVRSNNGTPDKIFNQNKIGKANGTSYVM 281 V +N+ S + +KR SA + S+ G D + N + G N + Sbjct: 5 VVKENIVASASSPMKKRRIDHTESADGSAINASNSSSIGGNDTVMNMAEFGNDNSNNQES 64 Query: 282 KNLKRVYDNLNNVRDTEGSKVNNDDEDRDEKLESSDVED 320 + + + ++ ++ D+ED D K ESS +++ Sbjct: 65 QQVCTFFKKPTKSKNIRKRTIDADEEDGDSKSESSILQN 103 >At3g29000.1 68416.m03624 calcium-binding EF hand family protein similar to calmodulin-like MSS3 GI:9965747 from [Arabidopsis thaliana]; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 194 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/43 (27%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Query: 280 VMKNLKRVYDNLNNVRDTEGSKVNNDDEDRDEKLESSDVEDDV 322 ++++ +RV+D NN +D + + +D+D D+ + D +DD+ Sbjct: 40 LLQHHQRVFDKKNN-KDQQETLTKQEDDDDDDDDDDDDDDDDI 81 >At1g76950.1 68414.m08958 zinc finger protein (PRAF1) / regulator of chromosome condensation (RCC1) family protein identical to zinc finger protein PRAF1 [Arabidopsis thaliana] gi|15811367|gb|AAL08940. Length = 1103 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Query: 266 FNQNKIGKANGTSYVMKNLKRVYDNLNNVRDTEGSKVNNDDEDRDEKLE 314 F++ + G+ ++ +N ++VY+ N VR +E S + DRDE+ E Sbjct: 1052 FSRRRFGEHQAETWWSENREKVYEKYN-VRVSEKSTASQTHRDRDEEEE 1099 >At4g02510.1 68417.m00343 chloroplast outer membrane protein, putative similar to chloroplast protein import component Toc159 [Pisum sativum] GI:8489806, chloroplast outer envelope protein 86 [Pisum sativum] GI:599958, GTP-binding protein [Pisum sativum] GI:576509 Length = 1503 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Query: 274 ANGTSYVMKNLKRVYDNLNNVRDTEGSKVNNDDEDRDEKLESSDVEDD 321 ++G V +N K+V +++ +++D SK+ N D D K S+D E + Sbjct: 131 SDGVGVVEEN-KKVKEDVEDIKDDGESKIENGSVDVDVKQASTDGESE 177 >At3g45830.1 68416.m04960 expressed protein Length = 1298 Score = 29.9 bits (64), Expect = 2.4 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 2/72 (2%) Query: 240 GRDFGRRHLSAFSVPVRSNNGTPDKI-FNQNKIGKANGTSYVMKNLKRVYDNLNNVRDTE 298 G +F RR L+A + + K F + +G T Y + Y+ + VR Sbjct: 270 GLEFPRRQLAAVEQDLYGKPKSKPKFPFAKTSVGPY-ATGYNGYGMNSAYNPSSLVRQRY 328 Query: 299 GSKVNNDDEDRD 310 GS+ N DD+D+D Sbjct: 329 GSEDNIDDDDQD 340 >At1g77030.1 68414.m08970 glycine-rich protein Length = 349 Score = 29.9 bits (64), Expect = 2.4 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Query: 220 KRVAPDNVDVSQTDDPEKRLGRDFGRRHLSAFSVPVRSNNGTPDKIFNQNKIGKANGTSY 279 K+V+ D+ D +T R GRD RR S + VRS D++ + + KAN SY Sbjct: 141 KKVSRDSGDADETTRMSGRGGRDGKRRQGSVPNAHVRSEIKDLDQV-RKERQQKANKVSY 199 Query: 280 V 280 + Sbjct: 200 L 200 >At1g55400.1 68414.m06336 hypothetical protein Length = 211 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/29 (44%), Positives = 17/29 (58%) Query: 296 DTEGSKVNNDDEDRDEKLESSDVEDDVID 324 D E +V+N DE+ + E DVEDD D Sbjct: 100 DAESDRVSNVDENNEAVDEQDDVEDDKTD 128 >At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar to RNA helicase [Rattus norvegicus] GI:897915; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 1166 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/41 (31%), Positives = 24/41 (58%) Query: 281 MKNLKRVYDNLNNVRDTEGSKVNNDDEDRDEKLESSDVEDD 321 +K +R D N + +GS+ + + R ++++SSD EDD Sbjct: 22 LKKSRRDRDRSNERKKDKGSEKRREKDRRKKRVKSSDSEDD 62 >At5g54260.1 68418.m06759 DNA repair and meiosis protein (Mre11) identical to DNA repair and meiosis protein (Mre11) GI:5524769 from [Arabidopsis thaliana] Length = 720 Score = 29.1 bits (62), Expect = 4.2 Identities = 22/95 (23%), Positives = 40/95 (42%), Gaps = 4/95 (4%) Query: 222 VAPDNVDVSQTDDPEKRLGRDFGRRHLSAFSVPVRSNNGTPDKIFNQNKIGKANGTSYVM 281 + D+VD +++ E DF + S+ G + G+ +GTS Sbjct: 617 IGEDDVDSPSSEEVEPE---DFNKPDSSSEDDESTKGKGRKRPATTKRGRGRGSGTSKRG 673 Query: 282 KNLKRVYDNLNNVRDTEGSKVNNDDEDRDEKLESS 316 + +LN + ++ + DDEDR++KL S Sbjct: 674 RK-NESSSSLNRLLSSKDDDEDEDDEDREKKLNKS 707 >At5g10510.1 68418.m01217 ovule development protein, putative similar to ovule development protein aintegumenta (GI:1209099) [Arabidopsis thaliana] Length = 566 Score = 29.1 bits (62), Expect = 4.2 Identities = 24/100 (24%), Positives = 41/100 (41%), Gaps = 1/100 (1%) Query: 217 YDRKRVAPDNVDVSQTDDPEKRLGRDFGRRHLSAFSVPVRSNNGTPDKIFNQNKIGKANG 276 +D K +A S E GR HL+ + + P+ F+ G + Sbjct: 125 HDFKTMAGFQSAFSTNSGSEVDDSASIGRTHLAGDYLGHVVESSGPELGFHGGSTGALSL 184 Query: 277 TSYVMKNLKRVYDNLNNVR-DTEGSKVNNDDEDRDEKLES 315 V N DN N+ R + G ++NN++ + +EK +S Sbjct: 185 GVNVNNNTNHRNDNDNHYRGNNNGERINNNNNNDNEKTDS 224 >At2g41880.1 68415.m05179 guanylate kinase 1 (GK-1) identical to guanylate kinase (GK-1) [Arabidopsis thaliana] gi|7861795|gb|AAF70408 Length = 387 Score = 28.7 bits (61), Expect = 5.6 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 2/77 (2%) Query: 214 GHIYDRKRVAP--DNVDVSQTDDPEKRLGRDFGRRHLSAFSVPVRSNNGTPDKIFNQNKI 271 G I K+ +P D++ + D P R + R+ + A+S VR N P I + + Sbjct: 89 GRILVIKKGSPRNDSIWFLEVDSPYVREQKKLLRKEVVAWSKGVRGNAEKPIVISGPSGV 148 Query: 272 GKANGTSYVMKNLKRVY 288 GK S +MK ++ Sbjct: 149 GKGTLISMLMKEFPSMF 165 >At1g47970.1 68414.m05343 expressed protein Length = 198 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Query: 282 KNLKRVYDNLNNVRDTEGSKVNNDDEDRDEKLESSDVEDDV 322 + +K V + +++ D +GS+ DD+D +E+ E D +DDV Sbjct: 29 EQVKDVGEEVSDEDDDDGSE--GDDDDDEEEEEDDDDDDDV 67 >At5g22840.1 68418.m02670 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 538 Score = 28.3 bits (60), Expect = 7.4 Identities = 23/98 (23%), Positives = 40/98 (40%), Gaps = 3/98 (3%) Query: 222 VAPDNVDVSQTDDPE---KRLGRDFGRRHLSAFSVPVRSNNGTPDKIFNQNKIGKANGTS 278 + P+N+ + T DPE ++ G + +VP R K + + N Sbjct: 177 IKPENILLCSTIDPEADARKSGIPLVLPTVKDKAVPERPVEKEKPKSYTYSADLTKNQKK 236 Query: 279 YVMKNLKRVYDNLNNVRDTEGSKVNNDDEDRDEKLESS 316 + K K+V + N RD+ S+ + E+LE S Sbjct: 237 KIRKKAKKVEGSEENERDSSNSEARPNGNATVERLEES 274 >At5g05740.2 68418.m00632 peptidase M50 family protein / sterol-regulatory element binding protein (SREBP) site 2 protease family protein contains Pfam PF02163: Sterol-regulatory element binding protein (SREBP) site 2 protease Length = 527 Score = 28.3 bits (60), Expect = 7.4 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 5/46 (10%) Query: 276 GTSYVMKNLK--RVY---DNLNNVRDTEGSKVNNDDEDRDEKLESS 316 GTS K+LK RV+ + L V +T+ NDDED E ESS Sbjct: 42 GTSRRKKDLKLERVFRKRETLVRVTETQTEPEGNDDEDNKEGKESS 87 >At5g05740.1 68418.m00631 peptidase M50 family protein / sterol-regulatory element binding protein (SREBP) site 2 protease family protein contains Pfam PF02163: Sterol-regulatory element binding protein (SREBP) site 2 protease Length = 556 Score = 28.3 bits (60), Expect = 7.4 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 5/46 (10%) Query: 276 GTSYVMKNLK--RVY---DNLNNVRDTEGSKVNNDDEDRDEKLESS 316 GTS K+LK RV+ + L V +T+ NDDED E ESS Sbjct: 42 GTSRRKKDLKLERVFRKRETLVRVTETQTEPEGNDDEDNKEGKESS 87 >At5g03950.1 68418.m00375 hypothetical protein Length = 252 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query: 286 RVYDNLNNVRDTEGSKVNNDDEDRDEKLESSDVEDD 321 RV D+++NV D V+ D+D D+K + E D Sbjct: 105 RVCDSVSNV-DENNEAVDEQDDDEDDKTNEDEEEGD 139 >At5g02850.1 68418.m00228 hydroxyproline-rich glycoprotein family protein Length = 426 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/43 (32%), Positives = 22/43 (51%) Query: 274 ANGTSYVMKNLKRVYDNLNNVRDTEGSKVNNDDEDRDEKLESS 316 AN + L + D+ ++ R + SK+ DDED D + SS Sbjct: 190 ANKLKDAERVLDMLVDDYSDYRKPKRSKIEEDDEDNDNESSSS 232 >At3g60110.1 68416.m06712 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487 Length = 438 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/32 (34%), Positives = 18/32 (56%) Query: 292 NNVRDTEGSKVNNDDEDRDEKLESSDVEDDVI 323 NN++ +K + D+D DEK E+S E + Sbjct: 291 NNIKKQTDTKTESSDDDDDEKEENSKTEKKTV 322 >At3g18390.1 68416.m02339 expressed protein contains Pfam domain, PF04581: Protein of unknown function (DUF578) Length = 848 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/28 (42%), Positives = 18/28 (64%) Query: 297 TEGSKVNNDDEDRDEKLESSDVEDDVID 324 +E N++D+D DE+ E DVED+ D Sbjct: 800 SESEWENDEDDDDDEEEEKDDVEDNESD 827 >At2g31210.1 68415.m03811 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain; PMID: 12679534 Length = 428 Score = 28.3 bits (60), Expect = 7.4 Identities = 19/39 (48%), Positives = 21/39 (53%), Gaps = 5/39 (12%) Query: 287 VYDNLNNVR-DTEGSKVNNDDEDRDEKLESSDVEDDVID 324 V DN NN D G N DD+D DE +E E DVID Sbjct: 284 VDDNNNNKNLDDHG---NEDDDDDDENMEKKP-ESDVID 318 >At1g75150.1 68414.m08729 expressed protein ; expression supported by MPSS Length = 753 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Query: 274 ANGTSYVMKNLKR-VYDNLNNVRDTEGSKVNNDDEDRDEKLESSDVE 319 A GT +++ LKR V + + + E V++DDE+R E + +V+ Sbjct: 472 AAGTEKLLQKLKRGVQHDETLLSEDEDDDVDDDDEERPEGADGEEVQ 518 >At1g55600.1 68414.m06364 WRKY family transcription factor similar to SPF1 protein GI:484261 from [Ipomoea batatas]; contains Pfam profile: PF03106 WRKY DNA -binding domain Length = 485 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/47 (27%), Positives = 24/47 (51%) Query: 271 IGKANGTSYVMKNLKRVYDNLNNVRDTEGSKVNNDDEDRDEKLESSD 317 IG TS+ + + + ++ ++ D+E N DD+D D + E D Sbjct: 194 IGTPLVTSFESELVDDAHTDIISIEDSESEDGNKDDDDEDFQYEDED 240 >At5g40110.1 68418.m04865 hypothetical protein Length = 280 Score = 27.9 bits (59), Expect = 9.7 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query: 286 RVYDNLNNVRDTEGSKVNNDDEDRDEKLESSDVEDD 321 RV D+++NV D V+ D+D D+K + E D Sbjct: 105 RVCDSVSNV-DENNEAVDEKDDDEDDKTNEDEEEGD 139 >At3g49410.1 68416.m05401 transcription factor-related contains weak similarity to transcription factor IIIC63 (GI:5281316) [Homo sapiens] Length = 559 Score = 27.9 bits (59), Expect = 9.7 Identities = 13/34 (38%), Positives = 20/34 (58%) Query: 281 MKNLKRVYDNLNNVRDTEGSKVNNDDEDRDEKLE 314 M+ K V +N++ + +G N DDED DE+ E Sbjct: 440 METFKSVNENVDANVNEDGEDENLDDEDEDEEEE 473 >At3g28320.1 68416.m03538 hypothetical protein similar to At14a (GI:11994571 and GI:11994573) [Arabidopsis thaliana] Length = 280 Score = 27.9 bits (59), Expect = 9.7 Identities = 14/61 (22%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Query: 262 PDKIFNQNKIGKANGTSYVMKNLKRVYDNLNNVRDTEGSKVNNDDEDRDEKLESSDVEDD 321 P++I + K G V + + + D ++++ T + ++ ++ D KL+ +EDD Sbjct: 185 PERITEGMEADK-EGMKSVPEQVDELKDQISSLLQTVDDAIGSEGDEVDVKLDMESLEDD 243 Query: 322 V 322 V Sbjct: 244 V 244 >At1g49920.1 68414.m05598 zinc finger protein-related weak similarity to mudrA [Zea mays] GI:540581, MURAZC [Zea mays] GI:1857256; contains Pfam profiles PF03108: MuDR family transposase, PF04434: SWIM zinc finger Length = 785 Score = 27.9 bits (59), Expect = 9.7 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 295 RDTEGSKVNNDDE-DRDEKLESSDVEDDVID 324 +DTE + D++ D DE+ E DV+DD D Sbjct: 743 KDTEDDHLEEDEDGDDDEEEEDDDVDDDEED 773 >At1g04500.1 68414.m00441 zinc finger CONSTANS-related similar to Zinc finger protein constans-like 15 (SP:Q9FHH8) {Arabidopsis thaliana} Length = 386 Score = 27.9 bits (59), Expect = 9.7 Identities = 20/61 (32%), Positives = 25/61 (40%), Gaps = 8/61 (13%) Query: 266 FNQNK--IGKANGTSYVMKNLKRVYDNLNNVRDTEGSKVNNDDEDRDEKLESSDVEDDVI 323 FNQ +NG YV N N NN D S N D ED ++ + S + D Sbjct: 38 FNQTSEVTSASNGCGYVENN------NTNNFPDKSNSGSNQDHEDNNDNADLSIIFDSQD 91 Query: 324 D 324 D Sbjct: 92 D 92 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.315 0.132 0.383 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,980,285 Number of Sequences: 28952 Number of extensions: 269959 Number of successful extensions: 1099 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 18 Number of HSP's that attempted gapping in prelim test: 1038 Number of HSP's gapped (non-prelim): 76 length of query: 324 length of database: 12,070,560 effective HSP length: 81 effective length of query: 243 effective length of database: 9,725,448 effective search space: 2363283864 effective search space used: 2363283864 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -