Silkworm BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001401-TA|BGIBMGA001401-PA|IPR003000|Silent information
regulator protein Sir2
         (370 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY661557-1|AAT74557.1|  411|Apis mellifera yellow-f-like protein...    23   4.2  

>AY661557-1|AAT74557.1|  411|Apis mellifera yellow-f-like protein
           protein.
          Length = 411

 Score = 23.0 bits (47), Expect = 4.2
 Identities = 10/31 (32%), Positives = 19/31 (61%)

Query: 328 NANDIEKSKMIKLEVKEENETKDWPLKPSDQ 358
           N   I + ++I +++K +   + +PLK SDQ
Sbjct: 136 NNTVIHQPRIIIIDLKTDKILRIYPLKSSDQ 166


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.316    0.135    0.404 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 108,588
Number of Sequences: 429
Number of extensions: 5066
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 4
Number of HSP's gapped (non-prelim): 1
length of query: 370
length of database: 140,377
effective HSP length: 59
effective length of query: 311
effective length of database: 115,066
effective search space: 35785526
effective search space used: 35785526
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 44 (21.8 bits)