GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001395-TA|BGIBMGA001395-PA|IPR001353|20S proteasome, A
and B subunits
         (192 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF069739-1|AAC63272.2|  690|Apis mellifera translation initiatio...    21   5.8  
DQ067178-1|AAZ20250.1|  448|Apis mellifera conserved ATPase doma...    21   7.6  

>AF069739-1|AAC63272.2|  690|Apis mellifera translation initiation
           factor 2 protein.
          Length = 690

 Score = 21.4 bits (43), Expect = 5.8
 Identities = 11/34 (32%), Positives = 16/34 (47%)

Query: 158 LVNAADRDAISGWGAVVYIIEKDKITEKHVKTRM 191
           L N+A RD       + +I + DK  E  + T M
Sbjct: 67  LANSAKRDINDVLNVLYFINKNDKYEENTILTTM 100


>DQ067178-1|AAZ20250.1|  448|Apis mellifera conserved ATPase domain
           protein protein.
          Length = 448

 Score = 21.0 bits (42), Expect = 7.6
 Identities = 8/13 (61%), Positives = 9/13 (69%)

Query: 100 DPYDNQPYVCNMD 112
           D YDN   VCNM+
Sbjct: 50  DAYDNCITVCNME 62


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.321    0.138    0.420 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 53,801
Number of Sequences: 429
Number of extensions: 1966
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of query: 192
length of database: 140,377
effective HSP length: 54
effective length of query: 138
effective length of database: 117,211
effective search space: 16175118
effective search space used: 16175118
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 42 (21.0 bits)