BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001394-TA|BGIBMGA001394-PA|undefined (64 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9RZJ3 Cluster: Transposase, putative; n=9; Deinococcus... 33 1.1 UniRef50_Q4WBJ5 Cluster: Glycosyl hydrolase family 43 protein; n... 30 7.8 >UniRef50_Q9RZJ3 Cluster: Transposase, putative; n=9; Deinococcus radiodurans|Rep: Transposase, putative - Deinococcus radiodurans Length = 327 Score = 33.1 bits (72), Expect = 1.1 Identities = 13/28 (46%), Positives = 20/28 (71%) Query: 19 KVRYTVDVTNYENGETSVTFAIVGATGH 46 KV ++D TN+E+GET + F ++GA H Sbjct: 55 KVLLSLDRTNWEHGETPINFLVLGAVVH 82 >UniRef50_Q4WBJ5 Cluster: Glycosyl hydrolase family 43 protein; n=7; Pezizomycotina|Rep: Glycosyl hydrolase family 43 protein - Aspergillus fumigatus (Sartorya fumigata) Length = 464 Score = 30.3 bits (65), Expect = 7.8 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Query: 5 SMNSITLVLFQSMMKVRYTVDVTNYENGETSVTFAIVGATGHTNV 49 S ++ +V +S R T+ V YENG++S +A+V G T V Sbjct: 355 SDGTLRIVGVESSASTRSTIRV-KYENGDSSQRYALVSVNGKTQV 398 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.320 0.128 0.369 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 61,846,628 Number of Sequences: 1657284 Number of extensions: 1638279 Number of successful extensions: 3889 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3888 Number of HSP's gapped (non-prelim): 2 length of query: 64 length of database: 575,637,011 effective HSP length: 44 effective length of query: 20 effective length of database: 502,716,515 effective search space: 10054330300 effective search space used: 10054330300 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 65 (30.3 bits)
- SilkBase 1999-2023 -