BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001393-TA|BGIBMGA001393-PA|undefined (721 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 25 2.4 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 24 4.2 EF125546-1|ABL73930.1| 237|Tribolium castaneum obstractor C2 pr... 23 7.3 EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 pr... 23 7.3 AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 23 9.7 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 24.6 bits (51), Expect = 2.4 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Query: 112 GYLKSWVLPVTKFAYYGGSISQENALNIFNFYKEVKRYLGTDGKSW 157 G+ W P A GGS S ++ F F E++R +GK+W Sbjct: 139 GFDLDWEYPGA--ADRGGSFSDKD--KFFYFVGELRRAFDKEGKNW 180 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.8 bits (49), Expect = 4.2 Identities = 9/16 (56%), Positives = 12/16 (75%) Query: 512 EPSKTVTLLNGGTVPG 527 EPS+TVT++ VPG Sbjct: 981 EPSETVTIITAEEVPG 996 >EF125546-1|ABL73930.1| 237|Tribolium castaneum obstractor C2 protein. Length = 237 Score = 23.0 bits (47), Expect = 7.3 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Query: 526 PGVEYDTKHKACCCSEQVSSIDTLKNNNV-GECTC 559 PG+ YD + + C ++QV KN V G TC Sbjct: 126 PGLAYDREARVCMWADQVPE---CKNEEVAGGFTC 157 >EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 protein. Length = 274 Score = 23.0 bits (47), Expect = 7.3 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Query: 526 PGVEYDTKHKACCCSEQVSSIDTLKNNNV-GECTC 559 PG+ YD + + C ++QV KN V G TC Sbjct: 126 PGLAYDREARVCMWADQVPE---CKNEEVAGGFTC 157 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 22.6 bits (46), Expect = 9.7 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 7/73 (9%) Query: 622 TKPYVEITIERPQNEISVGISTVTRNQGPNSHRPSKIPKRSVTAAGEAKLTCKPPASPED 681 T P+V+ ++ Q EI + T+ N G S+ + K E+ L PPA D Sbjct: 297 TNPHVQ---KKLQKEIDL---TLQENHGKISYNVLQSMKYLDQVVCES-LRLWPPAPQTD 349 Query: 682 RFQRKSFIPQPKK 694 R K+F+ + K Sbjct: 350 RLCNKNFVIEASK 362 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.133 0.395 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,571 Number of Sequences: 317 Number of extensions: 7049 Number of successful extensions: 19 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 18 Number of HSP's gapped (non-prelim): 5 length of query: 721 length of database: 114,650 effective HSP length: 62 effective length of query: 659 effective length of database: 94,996 effective search space: 62602364 effective search space used: 62602364 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -