BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001393-TA|BGIBMGA001393-PA|undefined (721 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 23 6.6 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 23 8.7 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 23.4 bits (48), Expect = 6.6 Identities = 7/23 (30%), Positives = 16/23 (69%) Query: 663 VTAAGEAKLTCKPPASPEDRFQR 685 + + G+ ++T K P +PE+++ R Sbjct: 259 IISRGQVRVTIKQPDTPEEKYIR 281 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 23.0 bits (47), Expect = 8.7 Identities = 11/31 (35%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Query: 503 QSYSTNQGLEPSKTVTLLNGGTVPGVEYDTK 533 Q ++ +GL+ S + L+NG T+P + + TK Sbjct: 269 QGHAILKGLKTS--IILMNGTTLPQIMWGTK 297 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.317 0.133 0.395 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,397 Number of Sequences: 429 Number of extensions: 9205 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 2 length of query: 721 length of database: 140,377 effective HSP length: 63 effective length of query: 658 effective length of database: 113,350 effective search space: 74584300 effective search space used: 74584300 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -