BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001392-TA|BGIBMGA001392-PA|IPR008946|Nuclear receptor, ligand-binding, IPR000536|Nuclear hormone receptor, ligand-binding (177 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 72 3e-15 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 52 4e-09 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 27 0.066 AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-mon... 21 4.3 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 21 4.3 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 21 4.3 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 71.7 bits (168), Expect = 3e-15 Identities = 33/66 (50%), Positives = 44/66 (66%) Query: 16 ILARNADACGLSDVTHIESLQEKSQCALEEYCRTQYPNQPTRFGKLLLRLPSLRTVSSQV 75 I+ N D G+ V +E L+EK LEEY RT +PN+P RF KLLLRLP+LR++ + Sbjct: 319 IILYNPDVRGIKSVQEVEMLREKIYGVLEEYTRTTHPNEPGRFAKLLLRLPALRSIGLKC 378 Query: 76 IEQLFF 81 +E LFF Sbjct: 379 LEHLFF 384 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 51.6 bits (118), Expect = 4e-09 Identities = 27/66 (40%), Positives = 39/66 (59%), Gaps = 1/66 (1%) Query: 32 IESLQEKSQCALEEYCRTQYPNQPTRFGKLLLRLPS-LRTVSSQVIEQLFFRYQREAQPE 90 I +Q+ +Q L ++ T YP QP RFGK+LL + S RT+S + IE LFF+ P Sbjct: 329 ISVIQDDAQMRLNKHVTTTYPKQPLRFGKILLLVSSTFRTISGRTIEDLFFKKVIRDTPI 388 Query: 91 DAVTSS 96 A+ S+ Sbjct: 389 VAIISN 394 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 27.5 bits (58), Expect = 0.066 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Query: 32 IESLQEKSQCALEEYCRTQYPNQP-TRFGKLLLRLPSLRTVSSQVIEQLF 80 +E +QE AL Y + +P T F KLL L LRT+ +Q E F Sbjct: 477 VEKIQEIYLEALRAYVDNRRKPKPGTIFAKLLSVLTELRTLGNQNSEMCF 526 >AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 290 Score = 21.4 bits (43), Expect = 4.3 Identities = 10/20 (50%), Positives = 12/20 (60%) Query: 98 EFQEAAETDYFARGRSSERA 117 E++E T FARGRS A Sbjct: 36 EYREDIRTAKFARGRSINMA 55 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.4 bits (43), Expect = 4.3 Identities = 10/20 (50%), Positives = 12/20 (60%) Query: 98 EFQEAAETDYFARGRSSERA 117 E++E T FARGRS A Sbjct: 36 EYREDIRTAKFARGRSINMA 55 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.4 bits (43), Expect = 4.3 Identities = 10/20 (50%), Positives = 12/20 (60%) Query: 98 EFQEAAETDYFARGRSSERA 117 E++E T FARGRS A Sbjct: 36 EYREDIRTAKFARGRSINMA 55 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.315 0.127 0.361 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 35,904 Number of Sequences: 317 Number of extensions: 1239 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 177 length of database: 114,650 effective HSP length: 53 effective length of query: 124 effective length of database: 97,849 effective search space: 12133276 effective search space used: 12133276 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -