Silkworm BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001388-TA|BGIBMGA001388-PA|undefined
         (113 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase pro...    21   4.7  

>AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase
           protein.
          Length = 580

 Score = 20.6 bits (41), Expect = 4.7
 Identities = 18/62 (29%), Positives = 26/62 (41%), Gaps = 7/62 (11%)

Query: 32  VYHHNAKYDAKLFRKRVENLHYVLPQVPSTIG-------KSIQGILAYDKTHSTASANIT 84
           VY   A +D  + R +   L  +L  VP+          KS+Q I  YD+ +    A I 
Sbjct: 95  VYGTLADFDRLVRRAKSLGLKVILDFVPNHSSHEHPWFKKSVQRIKPYDEYYVWRDARIV 154

Query: 85  QG 86
            G
Sbjct: 155 NG 156


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.323    0.137    0.415 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,862
Number of Sequences: 429
Number of extensions: 881
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 113
length of database: 140,377
effective HSP length: 50
effective length of query: 63
effective length of database: 118,927
effective search space:  7492401
effective search space used:  7492401
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (21.0 bits)
S2: 39 (19.8 bits)