BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001387-TA|BGIBMGA001387-PA|undefined (161 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 25 0.41 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 2.9 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 2.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 2.9 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 21 3.8 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 24.6 bits (51), Expect = 0.41 Identities = 19/41 (46%), Positives = 20/41 (48%), Gaps = 6/41 (14%) Query: 57 GKIFHRADKSTSLTVVPQQASIAASTGPSQPTHRTSWSYGT 97 GK FH KS PQ A +ST S PT RTS S T Sbjct: 61 GKGFHPWKKS------PQGAPSPSSTPSSLPTQRTSTSNPT 95 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.8 bits (44), Expect = 2.9 Identities = 10/36 (27%), Positives = 17/36 (47%) Query: 61 HRADKSTSLTVVPQQASIAASTGPSQPTHRTSWSYG 96 H + + V+P + A+S G P H +S+ G Sbjct: 96 HNIEITEVAPVLPGNYANASSVGSRNPIHTSSYMTG 131 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 2.9 Identities = 10/36 (27%), Positives = 17/36 (47%) Query: 61 HRADKSTSLTVVPQQASIAASTGPSQPTHRTSWSYG 96 H + + V+P + A+S G P H +S+ G Sbjct: 329 HNIEITEVAPVLPGNYANASSVGSRNPIHTSSYMTG 364 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 2.9 Identities = 10/36 (27%), Positives = 17/36 (47%) Query: 61 HRADKSTSLTVVPQQASIAASTGPSQPTHRTSWSYG 96 H + + V+P + A+S G P H +S+ G Sbjct: 329 HNIEITEVAPVLPGNYANASSVGSRNPIHTSSYMTG 364 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 21.4 bits (43), Expect = 3.8 Identities = 8/32 (25%), Positives = 18/32 (56%) Query: 10 KVKLAGYYAVEKILKDALYTSITTRVLTPVLF 41 K AG++ V+ L ++ S+T+ ++ + F Sbjct: 354 KFSAAGFFPVDFTLLGFIFGSVTSYIIISIQF 385 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.129 0.398 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 37,558 Number of Sequences: 317 Number of extensions: 1481 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 161 length of database: 114,650 effective HSP length: 52 effective length of query: 109 effective length of database: 98,166 effective search space: 10700094 effective search space used: 10700094 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.4 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -