BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001387-TA|BGIBMGA001387-PA|undefined (161 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK096772-1|BAC04860.1| 577|Homo sapiens protein ( Homo sapiens ... 29 9.9 >AK096772-1|BAC04860.1| 577|Homo sapiens protein ( Homo sapiens cDNA FLJ39453 fis, clone PROST2010046, highly similar to Homo sapiens secretory mucin MUC6 (MUC6) mRNA. ). Length = 577 Score = 28.7 bits (61), Expect = 9.9 Identities = 31/135 (22%), Positives = 49/135 (36%), Gaps = 2/135 (1%) Query: 28 YTSITTRVLTPVLFESRSRGTYFGKIYDKGKIFHRADKSTSLTVVPQQASIAASTGPSQP 87 + +T T + F+ S GT + R + P +S +STGP Sbjct: 65 HPEVTPTSTTNITFKHTSTGTRTPVAHTTSASSSRLPTPFTTHSPPTGSSPFSSTGPMTA 124 Query: 88 TH-RTSWSYGTQLHCLIT-PLQFIAAHDRIINAWGHTSPAWQLCIRWTTHDTHATFKLSL 145 T +T+ +Y T H T P ++ HT T+ H+T ++ Sbjct: 125 TSFQTTTTYPTPSHPQTTLPTHVPPFSTSLVTPSTHTVIITTHTQMATSASIHSTPTGTV 184 Query: 146 DSPQTSSSTGDNHAA 160 P T +TG H A Sbjct: 185 PPPTTLKATGSTHTA 199 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.319 0.129 0.398 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,290,677 Number of Sequences: 224733 Number of extensions: 928143 Number of successful extensions: 1669 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1669 Number of HSP's gapped (non-prelim): 1 length of query: 161 length of database: 73,234,838 effective HSP length: 84 effective length of query: 77 effective length of database: 54,357,266 effective search space: 4185509482 effective search space used: 4185509482 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -