BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001386-TA|BGIBMGA001386-PA|IPR000842|Phosphoribosyl pyrophosphate synthetase, IPR005946|Ribose-phosphate pyrophosphokinase, IPR000836|Phosphoribosyltransferase (365 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 24 1.8 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 1.8 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 24.2 bits (50), Expect = 1.8 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 4/52 (7%) Query: 35 VNKLDHVLPLTTR-MPNIKVFSGSSHPDLAQKIVDRLGIDLGKVVTKKFSNM 85 V+ +PL R +PN F S H + L +GK+V +KFS + Sbjct: 218 VHSSSFCIPLPVRVLPN---FPSSGHWQDQMSLPQMLADKIGKMVNQKFSEL 266 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 24.2 bits (50), Expect = 1.8 Identities = 14/47 (29%), Positives = 22/47 (46%) Query: 42 LPLTTRMPNIKVFSGSSHPDLAQKIVDRLGIDLGKVVTKKFSNMETC 88 LPL R G S LA+K+ DR+ + + V+T + + C Sbjct: 612 LPLNIRWSYPGEEMGGSSGVLAKKVADRVSMLMISVITARHAGEYVC 658 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.318 0.132 0.375 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,471 Number of Sequences: 429 Number of extensions: 3604 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 2 length of query: 365 length of database: 140,377 effective HSP length: 59 effective length of query: 306 effective length of database: 115,066 effective search space: 35210196 effective search space used: 35210196 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -