BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001385-TA|BGIBMGA001385-PA|IPR002937|Amine oxidase (470 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 24 2.6 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.8 bits (49), Expect = 2.6 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 3/38 (7%) Query: 75 GRPDPHDS---WYVLSNGDLAPDATCKEILANIDEEVC 109 G+ PH+S +YV NG L P + N +E +C Sbjct: 1210 GQYYPHESCSSFYVCVNGHLVPQNCAPGLHYNPEEHMC 1247 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.135 0.421 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,019 Number of Sequences: 317 Number of extensions: 5066 Number of successful extensions: 3 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 1 length of query: 470 length of database: 114,650 effective HSP length: 59 effective length of query: 411 effective length of database: 95,947 effective search space: 39434217 effective search space used: 39434217 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -