GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001385-TA|BGIBMGA001385-PA|IPR002937|Amine oxidase
         (470 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    24   2.6  

>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 23.8 bits (49), Expect = 2.6
 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 3/38 (7%)

Query: 75   GRPDPHDS---WYVLSNGDLAPDATCKEILANIDEEVC 109
            G+  PH+S   +YV  NG L P      +  N +E +C
Sbjct: 1210 GQYYPHESCSSFYVCVNGHLVPQNCAPGLHYNPEEHMC 1247


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.318    0.135    0.421 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 113,019
Number of Sequences: 317
Number of extensions: 5066
Number of successful extensions: 3
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2
Number of HSP's gapped (non-prelim): 1
length of query: 470
length of database: 114,650
effective HSP length: 59
effective length of query: 411
effective length of database: 95,947
effective search space: 39434217
effective search space used: 39434217
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 45 (22.2 bits)