BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001385-TA|BGIBMGA001385-PA|IPR002937|Amine oxidase (470 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 27 1.1 AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 pr... 27 1.4 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 27.1 bits (57), Expect = 1.1 Identities = 18/68 (26%), Positives = 31/68 (45%) Query: 103 NIDEEVCKSHKNNVQSISQFVRNAVNTKETFKQFPRLTRSLLEVYERNNHLGGQDDPQHG 162 N++ E K NVQ + V++ ++ ETFKQ R +E + L Q+ H Sbjct: 832 NLEFERSKDTSKNVQRWERAVQDDEDSLETFKQAEARQRQEIEKDKEKIELMKQEKAAHK 891 Query: 163 KSLKGLDE 170 + ++E Sbjct: 892 TLVDQMEE 899 >AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 26.6 bits (56), Expect = 1.4 Identities = 11/34 (32%), Positives = 14/34 (41%) Query: 139 LTRSLLEVYERNNHLGGQDDPQHGKSLKGLDEHW 172 L R Y+R ++ Q DP G L E W Sbjct: 90 LVRDFRHFYDRGGYINRQHDPLSGHMLNSGSERW 123 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.318 0.135 0.421 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 501,772 Number of Sequences: 2123 Number of extensions: 20554 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 18 Number of HSP's gapped (non-prelim): 2 length of query: 470 length of database: 516,269 effective HSP length: 66 effective length of query: 404 effective length of database: 376,151 effective search space: 151965004 effective search space used: 151965004 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -